Clone Name | rbart06d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YEH7_YEAST (P39978) Hypothetical 21.7 kDa protein in HXT8-CAN1 i... | 30 | 2.1 | 2 | ATKA_HALSA (P57684) Potassium-transporting ATPase A chain (EC 3.... | 29 | 4.6 | 3 | SAP3_HUMAN (P17900) Ganglioside GM2 activator precursor (GM2-AP)... | 29 | 4.6 |
---|
>YEH7_YEAST (P39978) Hypothetical 21.7 kDa protein in HXT8-CAN1 intergenic| region Length = 195 Score = 30.4 bits (67), Expect = 2.1 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +1 Query: 16 LLYFVSNQINSSARHRPMENKYRFPP-----IRAA*LACHGHMREGYRHLCFVPPDAALP 180 +LY +N ++H P+ RFPP + C +++ R +C VPPD L Sbjct: 43 ILYARFPLLNILSQHSPVYCSRRFPPDNDLITGLGNIRCGQLVKKALRRVCNVPPDHQLI 102 Query: 181 AWLPCLS*AAATFIW 225 A + + A F++ Sbjct: 103 ASVRSIGYARVAFVF 117
>ATKA_HALSA (P57684) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 582 Score = 29.3 bits (64), Expect = 4.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 267 EMETSDHRPPKRFRWFFRIQMLFS 338 E SDHRPP WF R+ +F+ Sbjct: 34 EQANSDHRPPGYLSWFERLDEIFT 57
>SAP3_HUMAN (P17900) Ganglioside GM2 activator precursor (GM2-AP) (Cerebroside| sulfate activator protein) (Shingolipid activator protein 3) (SAP-3) [Contains: Ganglioside GM2 activator isoform short] Length = 193 Score = 29.3 bits (64), Expect = 4.6 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 91 PIRAA*LACHGHMREGYRHLC---FVPPDAALPAWL 189 P+R L CH +EG L FV PD LP+WL Sbjct: 128 PLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWL 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,470,417 Number of Sequences: 219361 Number of extensions: 1289792 Number of successful extensions: 3143 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3143 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)