Clone Name | rbart06d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LCAP_RAT (P97629) Leucyl-cystinyl aminopeptidase (EC 3.4.11.3) (... | 28 | 5.3 | 2 | POT2_ARATH (O22881) Potassium transporter 2 (AtPOT2) (AtKUP2) (A... | 28 | 6.9 |
---|
>LCAP_RAT (P97629) Leucyl-cystinyl aminopeptidase (EC 3.4.11.3) (Cystinyl| aminopeptidase) (Oxytocinase) (OTase) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Placental leucine aminopeptidase) (P-LAP) (Vesicle prot Length = 1025 Score = 28.5 bits (62), Expect = 5.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 129 YPYFREVTVPARRVKTTISRYTVKKPRSSNLGSSLPGF 16 YPY ++ V A T YT+K S+N+ +S GF Sbjct: 237 YPYHEQIAVVAPESLLTGHNYTLKIEYSANISNSYYGF 274
>POT2_ARATH (O22881) Potassium transporter 2 (AtPOT2) (AtKUP2) (AtKT2)| Length = 794 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 4 FMFFKTRQARPKVG*PGFLNCVAGDGGLYPSXGNCNFSKIRIATT 138 FMF + + + G L C+ G ++ G+ N++ I+IA T Sbjct: 258 FMFLRKTRVSGWMSLGGILLCITGAEAMFADLGHFNYAAIQIAFT 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,101,252 Number of Sequences: 219361 Number of extensions: 319971 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)