Clone Name | rbart06d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | WAP_MOUSE (P01173) Whey acidic protein precursor (WAP) | 28 | 5.2 | 2 | VLDLR_CHICK (P98165) Very low-density lipoprotein receptor precu... | 28 | 6.8 |
---|
>WAP_MOUSE (P01173) Whey acidic protein precursor (WAP)| Length = 134 Score = 28.5 bits (62), Expect = 5.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 133 CSSGIYCANCNCLLKCSPP 77 CS + C N +C++ C+PP Sbjct: 109 CSGNMKCCNVDCVMTCTPP 127
>VLDLR_CHICK (P98165) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) (Vitellogenin receptor) (VTG receptor) Length = 863 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 148 SGLPGCSSGIYCANCNCLLKCS-PPKFSL*CGPC 50 +G+ C G ANCN +++CS P KF G C Sbjct: 316 NGVRDCLDGTDEANCNNVIQCSGPGKFKCRSGEC 349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,003,501 Number of Sequences: 219361 Number of extensions: 303943 Number of successful extensions: 733 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)