ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart06c11 |
|---|---|
| Clone Library Name | barley_pub |
>WBS14_MOUSE (Q99MZ3) Williams-Beuren syndrome chromosome region 14 protein| homolog (Mlx interactor) (MLX-interacting protein-like) Length = 864 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 99 RQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRR 194 R+ + R QV+H+GH S PH L RRR Sbjct: 35 RRSAGGLHRSQVIHSGHFMVSSPHSDSLTRRR 66
>WBS14_HUMAN (Q9NP71) Williams-Beuren syndrome chromosome region 14 protein (WS| basic-helix-loop-helix leucine zipper protein) (WS-bHLH) (Mlx interactor) (MLX-interacting protein-like) Length = 852 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 99 RQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRR 194 R+ + R QV+H+GH S PH L RRR Sbjct: 35 RRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRR 66
>SVS5_RAT (P04812) Seminal vesicle secretory protein 5 precursor (Seminal| vesicle secretory protein V) (SVS V) (SVS protein F) Length = 123 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 51 SKFYLFNKS-NNRSHWRRQRTSKVCRRQVMHAGH--LSSSCPHVGHLIRRRRGGASL 212 S F F++S N+RS+++ + S + R +V +SS+ H G +RR GG + Sbjct: 53 STFGAFSRSENSRSNFKSKSPSSITREKVNEESRSEMSSTSSHFGLKMRRSHGGGEM 109
>PCAB_PSEPU (P32427) 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)| (3-carboxymuconate lactonizing enzyme) (CMLE) Length = 407 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 123 GKPCWCVASSNASGCLIC*ISKILIVYMFLFE 28 G PCWC +S ASG L SK + V L E Sbjct: 184 GPPCWCCSSGGASGSLAALGSKAMPVAEALAE 215
>ZN567_HUMAN (Q8N184) Zinc finger protein 567| Length = 616 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +3 Query: 21 LEIQIKTYKQSKFYLFNKSNNRSHWRRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRR 194 L + KT+ + K Y+ ++ RQ+T+ V ++ H G S CPH G R + Sbjct: 405 LALHEKTHNEEKPYICSECGKSF---RQKTTLVAHQRT-HTGEKSYECPHCGKAFRMK 458
>FLGF_BUCBP (Q89AH8) Flagellar basal-body rod protein flgF| Length = 248 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 18 NLEIQIKTYKQSKFYLFNKSNNRSHWRRQRTSKV 119 N +I TYK + YL NK+N +H + S + Sbjct: 162 NFDINDLTYKTNGLYLLNKNNKLNHTNHKNVSNI 195
>ZN689_RAT (Q99PJ7) Zinc finger protein 689 (Transcription factor HIT-39)| Length = 500 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +3 Query: 96 RRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRRRGGASLEEAFNGRLPQR 245 R + + + QV+H G CP G RR R A+ G P + Sbjct: 213 RFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQ 262
>ZN689_MOUSE (Q8BKK5) Zinc finger protein 689| Length = 500 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +3 Query: 96 RRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRRRGGASLEEAFNGRLPQR 245 R + + + QV+H G CP G RR R A+ G P + Sbjct: 213 RFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQ 262
>ZN689_HUMAN (Q96CS4) Zinc finger protein 689| Length = 500 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +3 Query: 96 RRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRRRGGASLEEAFNGRLPQR 245 R + + + QV+H G CP G RR R A+ G P + Sbjct: 213 RFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQ 262
>KAP1_RAT (P81377) cAMP-dependent protein kinase type I-beta regulatory| subunit Length = 380 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 42 YKQSKFYLFNKSNNRSHWRRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRRRGGASLE 215 + + F K NR RQ+++ C H +S + P+ RRRRGG S E Sbjct: 48 FLREHFEKLEKEENRQILARQKSNSQCDS---HDEEISPTPPNPVVKARRRRGGVSAE 102
>KAP1_MOUSE (P12849) cAMP-dependent protein kinase type I-beta regulatory| subunit Length = 380 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 42 YKQSKFYLFNKSNNRSHWRRQRTSKVCRRQVMHAGHLSSSCPHVGHLIRRRRGGASLE 215 + + F K NR RQ+++ C H +S + P+ RRRRGG S E Sbjct: 48 FLREHFEKLEKEENRQILARQKSNSQCDS---HDEEISPTPPNPVVKARRRRGGVSAE 102
>NCOR2_HUMAN (Q9Y618) Nuclear receptor corepressor 2 (N-CoR2) (Silencing| mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) (CTG repeat p Length = 2517 Score = 27.7 bits (60), Expect = 7.2 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Frame = +3 Query: 3 RQHTNNLEIQIKTYKQSKFYLFNKSNNRSHWRRQRTSKVCRR--QVMHAGHLSSSCPHVG 176 RQ+ N++I K+ Y R+H R+Q K C+R Q+M A L + Sbjct: 264 RQYHENIKINQAMRKKLILYF----KRRNHARKQWKQKFCQRYDQLMEA--LEKKVERIE 317 Query: 177 HLIRRRRGGASLEEAFNGRLPQ 242 + RRR + + E + + P+ Sbjct: 318 NNPRRRAKESKVREYYEKQFPE 339
>SRMB_HAEIN (P44701) ATP-dependent RNA helicase srmB homolog (EC 3.6.1.-)| Length = 439 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 166 GQEDDRCPACMTWRRQTLLVRCLLQCERLFDLLNK 62 GQ+ ++ A WR+QTLL L+ E L D + Sbjct: 168 GQDAEKIAAETRWRKQTLLFSATLEGELLVDFAER 202
>TRUD_THET8 (Q5SI49) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 356 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 135 MHAGHLSSSCPHVGHLIRRRRGGASLEEAFNGRLPQRG 248 + GHL + H+ LIRR +GG + EA RL ++G Sbjct: 124 LRTGHLKGNRFHI--LIRRPKGGVAEAEAVLKRLAEKG 159
>TRUD_THET2 (Q72IG5) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 356 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 135 MHAGHLSSSCPHVGHLIRRRRGGASLEEAFNGRLPQRG 248 + GHL + H+ LIRR +GG + EA RL ++G Sbjct: 124 LRTGHLKGNRFHI--LIRRPKGGVAEAEAVLKRLAEKG 159
>CH602_CORDI (Q6NF74) 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2)| Length = 546 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -1 Query: 359 VGAAVRVPETKRKEEISAAVREVMAGQGKGAEVRAKVATLR 237 VGAA V T+RK I AVR A +G VA L+ Sbjct: 384 VGAATEVELTERKHRIEDAVRNAKAAVEEGIVAGGGVALLQ 424
>URE1_NITOC (Q3J770) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 566 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 67 LTNQTTARIGGGNAPARFAGAKSCMP 144 LT+ T IGGG PA A +C P Sbjct: 146 LTSGVTTLIGGGTGPATGTNATTCTP 171
>YOD1_SCHPO (Q9UUD8) Probable peptidase C18A7.01 (EC 3.4.-.-)| Length = 451 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 241 NVATFALTSAPLPC--PAITSLTAAEISSFLFVSG 339 N+AT A + PC P IT AE+ + LFV G Sbjct: 234 NIATVAAIRSVQPCIKPGITEKELAEVINMLFVYG 268
>ISPF_CORDI (Q6NFC2) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC| 4.6.1.12) (MECPS) (MECDP-synthase) Length = 160 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = -3 Query: 126 AGKPCW--CVASSNASGC 79 AGKPCW C+ S A GC Sbjct: 21 AGKPCWIACLLFSGADGC 38
>FLID_SALTY (P16328) Flagellar hook-associated protein 2 (HAP2) (Filament cap| protein) (Flagellar cap protein) Length = 466 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 332 TKRKEEISAAVREVMAGQGKGAEVRAKVAT 243 TK ++ +AA RE++ G GK + K+AT Sbjct: 362 TKVLKDNTAAARELLVGDGKETGITTKIAT 391
>HELX_METTH (O27830) Putative ATP-dependent helicase MTH1802 (EC 3.6.1.-)| Length = 862 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 320 EEISAAVREVMAGQGKGAEVRAKVAT 243 EE +A+R++ AG+G+ E+R V T Sbjct: 105 EEPLSAIRDIAAGEGRDLEIRKAVRT 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,739,149 Number of Sequences: 219361 Number of extensions: 593421 Number of successful extensions: 2048 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2046 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
