Clone Name | rbaet99g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BRD1_HUMAN (O95696) Bromodomain-containing protein 1 (BR140-like... | 29 | 2.7 | 2 | POT13_ARATH (Q8LPL8) Potassium transporter 13 (AtPOT13) (AtKT5) | 28 | 4.6 |
---|
>BRD1_HUMAN (O95696) Bromodomain-containing protein 1 (BR140-like protein)| Length = 1058 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +1 Query: 34 LSRSKHLMNRIKRTNELV*SMTHPPFSDNTKKHLI*PQGTVRIYFYSPPA 183 L +H NR+K+ NE + S P S + P+ VRI YSPP+ Sbjct: 87 LRTKRHKNNRVKKKNEALPSAHGTPASASAL-----PEPKVRIVEYSPPS 131
>POT13_ARATH (Q8LPL8) Potassium transporter 13 (AtPOT13) (AtKT5)| Length = 855 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -3 Query: 145 VVKLGVFSC-CRKTVGGSWIILVHLFS*FCSLDVWTWTTS---STKIQK 11 +V+L FS C GSWIILV F + VW + + T++QK Sbjct: 541 IVELVFFSSVCSSVADGSWIILVFATIMFLIMFVWNYGSKLKYETEVQK 589 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,402,499 Number of Sequences: 219361 Number of extensions: 709290 Number of successful extensions: 1168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)