Clone Name | rbaet99g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RAD54_CHICK (O12944) DNA repair and recombination protein RAD54-... | 31 | 0.79 | 2 | ULT2_ARATH (Q8S8I2) Protein ULTRAPETALA2 | 31 | 1.0 | 3 | ULT1_ARATH (Q8GZA8) Protein ULTRAPETALA1 | 30 | 1.4 | 4 | SLBP_CAEEL (Q09599) Histone RNA hairpin-binding protein (Histone... | 30 | 2.3 | 5 | YD29_SCHPO (Q10257) Hypothetical protein C56F8.09 in chromosome I | 28 | 8.8 | 6 | HEMA_PTV10 (Q70KP1) Hemagglutinin-esterase homolog precursor (EC... | 28 | 8.8 |
---|
>RAD54_CHICK (O12944) DNA repair and recombination protein RAD54-like (EC| 3.6.1.-) (RAD54 homolog) (Putative recombination factor GdRad54) (Fragment) Length = 733 Score = 31.2 bits (69), Expect = 0.79 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 119 EKERGRSKILRLRLRQKAGRSAASCTCFRSPF 24 E+E G + + RQKAG A S C+RSPF Sbjct: 9 EEEDGEWRPPATQKRQKAGSEAESADCYRSPF 40
>ULT2_ARATH (Q8S8I2) Protein ULTRAPETALA2| Length = 228 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 122 KEKERGRSKILRLRLRQKAGRSAASCTCFRSPFCR 18 +E+ERG K+ R R + + SC CF CR Sbjct: 175 EEEERGSRKVFRGCTRSPSCKGCTSCVCFGCKLCR 209
>ULT1_ARATH (Q8GZA8) Protein ULTRAPETALA1| Length = 237 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 122 KEKERGRSKILRLRLRQKAGRSAASCTCFRSPFCR 18 +E+ERG K+ R R + + SC CF CR Sbjct: 185 EEEERGSRKVYRGCTRSPSCKGCTSCVCFGCELCR 219
>SLBP_CAEEL (Q09599) Histone RNA hairpin-binding protein (Histone| stem-loop-binding protein) Length = 367 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 7 KTKPRQKGERKHVQDAAERPAFCRSLSLS 93 K++ R+KG+ K Q++ +P F RSL L+ Sbjct: 68 KSESRRKGQPKRAQNSQNKPKFVRSLELT 96
>YD29_SCHPO (Q10257) Hypothetical protein C56F8.09 in chromosome I| Length = 318 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 4 RKTKPRQKGERKHVQDAAER 63 RK K R+KGERK+V D E+ Sbjct: 23 RKEKKRKKGERKNVGDKGEK 42
>HEMA_PTV10 (Q70KP1) Hemagglutinin-esterase homolog precursor (EC 3.1.1.53)| (HE) Length = 430 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 93 TQA*TPAKGRPFSCILYMFPFSFLPGFCF 7 TQ P+ FSC ++ PF ++ G CF Sbjct: 194 TQFVLPSSSDGFSCTKHLVPFCYIDGGCF 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,150,919 Number of Sequences: 219361 Number of extensions: 296504 Number of successful extensions: 825 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)