Clone Name | rbaet99f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PCD10_HUMAN (Q9P2E7) Protocadherin-10 precursor | 30 | 2.2 | 2 | RN139_MOUSE (Q7TMV1) RING finger protein 139 | 29 | 3.8 | 3 | RN139_HUMAN (Q8WU17) RING finger protein 139 (Translocation in r... | 29 | 3.8 |
---|
>PCD10_HUMAN (Q9P2E7) Protocadherin-10 precursor| Length = 1040 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -2 Query: 215 RPKQANSLLSYNMVSCQVHFISLFTFV 135 R + AN+ L+Y+++ CQ+ +S+FT+V Sbjct: 490 RDEGANAQLAYSILECQIQGMSVFTYV 516
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 156 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 16 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433
>RN139_HUMAN (Q8WU17) RING finger protein 139 (Translocation in renal carcinoma| on chromosome 8) Length = 664 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 156 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 16 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,994,091 Number of Sequences: 219361 Number of extensions: 427769 Number of successful extensions: 958 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)