Clone Name | rbaet99f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UREE_YERFR (Q6UR67) Urease accessory protein ureE | 29 | 2.9 | 2 | CYP4_CAEEL (P52012) Peptidyl-prolyl cis-trans isomerase 4 (EC 5.... | 29 | 3.8 |
---|
>UREE_YERFR (Q6UR67) Urease accessory protein ureE| Length = 239 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 37 SHFHDSKFKTHRLLNGHSHSH 99 SH HDS +H +GHSHSH Sbjct: 210 SHSHDSHSHSHDSDHGHSHSH 230
>CYP4_CAEEL (P52012) Peptidyl-prolyl cis-trans isomerase 4 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-4) (Cyclophilin mog-6) (Masculinisation of germline protein 6) Length = 523 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +3 Query: 99 HSTTTLHRLVIYLSHVSGDPLVAGDGGLDVLDTPVGD 209 ++ T HRL+ GDP G GG + D P D Sbjct: 316 YNNTKFHRLIKNFMLQGGDPTGTGHGGESIWDKPFSD 352 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,900,178 Number of Sequences: 219361 Number of extensions: 468505 Number of successful extensions: 1586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)