Clone Name | rbaet99c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SCRR_KLEPN (P37076) Sucrose operon repressor (Scr operon regulat... | 29 | 2.6 | 2 | MRP4_ARATH (Q7DM58) Multidrug resistance-associated protein 4 (E... | 27 | 9.9 | 3 | RUSC1_MOUSE (Q8BG26) RUN and SH3 domain-containing protein 1 | 27 | 9.9 | 4 | RUSC1_HUMAN (Q9BVN2) RUN and SH3 domain-containing protein 1 (Ne... | 27 | 9.9 |
---|
>SCRR_KLEPN (P37076) Sucrose operon repressor (Scr operon regulatory protein)| Length = 334 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = +3 Query: 111 VTGKGK*LNYEQFRRVVLCACARTRHFMASPHAACRAMHAHRQHCTIG 254 + G+GK L Q R + A AR +H+ S HA R++ +R H TIG Sbjct: 26 LNGRGKELRVAQETRERVLAIAREQHYQPSIHA--RSLRDNRSH-TIG 70
>MRP4_ARATH (Q7DM58) Multidrug resistance-associated protein 4 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 4) (ATP-energized glutathione S-conjugate pump 4) Length = 1516 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = -3 Query: 133 SYFPFPVTVWCILLSIQGISG 71 S+F FP+T + ++ S++GI+G Sbjct: 205 SFFSFPLTAFLLIASVRGITG 225
>RUSC1_MOUSE (Q8BG26) RUN and SH3 domain-containing protein 1| Length = 893 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +3 Query: 192 MASPHAA--CRAMHAHRQHCTIGSYATHAVAMATG---TPPP 302 M SP A C H H QH ++G + + + G TPPP Sbjct: 1 MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELREGPLSTPPP 42
>RUSC1_HUMAN (Q9BVN2) RUN and SH3 domain-containing protein 1 (New molecule| containing SH3 at the carboxy-terminus) (Nesca) Length = 902 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +3 Query: 192 MASPHAA--CRAMHAHRQHCTIGSYATHAVAMATG---TPPP 302 M SP A C H H QH ++G + + + G TPPP Sbjct: 1 MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELQEGSLSTPPP 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,208,927 Number of Sequences: 219361 Number of extensions: 731350 Number of successful extensions: 1889 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1888 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)