Clone Name | rbaet99b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZFY_PANTR (Q6B4Z5) Zinc finger Y-chromosomal protein | 28 | 8.1 | 2 | ZFY_HUMAN (P08048) Zinc finger Y-chromosomal protein | 28 | 8.1 | 3 | ZFY_GORGO (Q52V16) Zinc finger Y-chromosomal protein | 28 | 8.1 |
---|
>ZFY_PANTR (Q6B4Z5) Zinc finger Y-chromosomal protein| Length = 801 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 TARFYYCIYKRSNSRKLKSEVLSVHSHKSNH 239 T + +C +K SNS LK V+SVH+ H Sbjct: 628 THQCLHCDHKSSNSSDLKRHVISVHTKDYPH 658
>ZFY_HUMAN (P08048) Zinc finger Y-chromosomal protein| Length = 801 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 TARFYYCIYKRSNSRKLKSEVLSVHSHKSNH 239 T + +C +K SNS LK V+SVH+ H Sbjct: 628 THQCLHCDHKSSNSSDLKRHVISVHTKDYPH 658
>ZFY_GORGO (Q52V16) Zinc finger Y-chromosomal protein| Length = 801 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 TARFYYCIYKRSNSRKLKSEVLSVHSHKSNH 239 T + +C +K SNS LK V+SVH+ H Sbjct: 628 THQCLHCDHKSSNSSDLKRHVISVHTKDYPH 658 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,157,166 Number of Sequences: 219361 Number of extensions: 645819 Number of successful extensions: 1481 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)