Clone Name | rbaet98g09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RECN_XYLFT (Q87BS5) DNA repair protein recN (Recombination prote... | 28 | 4.9 | 2 | CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel al... | 28 | 6.4 | 3 | CDD_BACHD (Q9KD53) Cytidine deaminase (EC 3.5.4.5) (Cytidine ami... | 28 | 8.4 |
---|
>RECN_XYLFT (Q87BS5) DNA repair protein recN (Recombination protein N)| Length = 557 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 18 IHSLGHTLGSINLHCAQLGRGHLARSMMMIQINTQSTCSYTLIHDVQV 161 +H+ HTL +N H A+LG MIQ++ T + +D+ + Sbjct: 245 LHAARHTLSRVNEHDARLGEVETLLDNAMIQVDEALTLLDRIHNDLNI 292
>CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel alpha-1C subunit| (Voltage-gated calcium channel alpha subunit Cav1.2) (Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle) (Smooth muscle calcium channel blocker receptor) Length = 2171 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 105 IQINTQSTCSYTLIHDVQV-HMHISSDGQTDG 197 + T+STC T++H+ Q+ H +IS G G Sbjct: 20 LSAETESTCKGTVVHEAQLNHFYISPGGSNYG 51
>CDD_BACHD (Q9KD53) Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase)| (CDA) Length = 132 Score = 27.7 bits (60), Expect = 8.4 Identities = 7/30 (23%), Positives = 18/30 (60%) Frame = -1 Query: 112 ICIIIIERARCPLPSCAQCKLIEPKVCPSE 23 + I ++ + P+P C C+ + ++CP++ Sbjct: 71 VAIAVVADTKRPVPPCGACRQVMAELCPAD 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,305,064 Number of Sequences: 219361 Number of extensions: 628805 Number of successful extensions: 2001 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2001 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)