Clone Name | rbaet98g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HADD_PSEPU (Q52086) (R)-2-haloacid dehalogenase (EC 3.8.1.9) (D-... | 29 | 3.5 | 2 | VMSA_HBVWP (Q02317) Major surface antigen precursor | 28 | 4.6 |
---|
>HADD_PSEPU (Q52086) (R)-2-haloacid dehalogenase (EC 3.8.1.9) (D-2-haloacid| dehalogenase) (D-DEX) Length = 301 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +3 Query: 108 PWNGIARWITACLRHFSSKFSRRYTTSGILIARAMRRHGHSKWQSSVQKRTWELLGGFLV 287 PW G+ A R F ++ RR+ S + H + ++ R+WEL+G V Sbjct: 47 PWVGVITQAVAYYRPFFAEAWRRFAPSA-------KTHFFERASDDIRIRSWELMGQSFV 99 Query: 288 L 290 + Sbjct: 100 I 100
>VMSA_HBVWP (Q02317) Major surface antigen precursor| Length = 399 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 257 PLLNGTLPFAMPMPPHCSSNKYSGRRVTP 171 P G L MPP S+N+ SGR+ TP Sbjct: 78 PQAQGILATVPAMPPPASTNRQSGRQPTP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,477,452 Number of Sequences: 219361 Number of extensions: 926809 Number of successful extensions: 2396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2396 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)