Clone Name | rbaet98g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MATK_CHAGO (Q7YKY4) Maturase K (Intron maturase) | 28 | 4.7 | 2 | C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associate... | 28 | 6.1 | 3 | MATK_CHACO (Q7YKY5) Maturase K (Intron maturase) | 28 | 8.0 |
---|
>MATK_CHAGO (Q7YKY4) Maturase K (Intron maturase)| Length = 516 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 72 RNIITYYSGCCTSKNRGKSQ 131 RNII YYSGC + GK Q Sbjct: 419 RNIILYYSGCSNRSDLGKIQ 438
>C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1982 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 11/40 (27%) Frame = +3 Query: 120 GKSQPKTKVKK-------EAEEEGEQLNWSW----PGDRS 206 GK +PKT+ K +++ +GE++N SW PG+RS Sbjct: 292 GKGEPKTESKSSKFKSNSDSDYKGERINSSWEKETPGERS 331
>MATK_CHACO (Q7YKY5) Maturase K (Intron maturase)| Length = 516 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 72 RNIITYYSGCCTSKNRGKSQ 131 RNI+ YYSGC + GK Q Sbjct: 419 RNILLYYSGCSNRSDLGKIQ 438 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,627,697 Number of Sequences: 219361 Number of extensions: 349209 Number of successful extensions: 1770 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1761 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)