Clone Name | rbaet98g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NAS18_CAEEL (Q21179) Zinc metalloproteinase nas-18 precursor (EC... | 27 | 9.7 |
---|
>NAS18_CAEEL (Q21179) Zinc metalloproteinase nas-18 precursor (EC 3.4.24.21)| (Nematode astacin 18) Length = 410 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 194 TTPSYNSVCVCACGFWFVMC-LASYIGRVTG 105 T PS S C+C G+ V+C S IG+ TG Sbjct: 275 TNPSKCSECICPLGYGGVLCDRPSLIGKDTG 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,632,838 Number of Sequences: 219361 Number of extensions: 757570 Number of successful extensions: 1535 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)