ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet98e05 |
|---|---|
| Clone Library Name | barley_pub |
>POR_AVESA (P15904) Protochlorophyllide reductase (EC 1.3.1.33) (PCR)| (NADPH-protochlorophyllide oxidoreductase) (POR) (Fragment) Length = 313 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASDPEKARKVWELSE LVGLA Sbjct: 288 QLSQEASDPEKARKVWELSEKLVGLA 313
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASDPEKARKVWELSE LVGLA Sbjct: 363 QLSQEASDPEKARKVWELSEKLVGLA 388
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASDPEKARKVWELSE LVGLA Sbjct: 363 QLSQEASDPEKARKVWELSEKLVGLA 388
>PORA_CUCSA (Q41249) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 48.9 bits (115), Expect = 3e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASD EKARKVWELSE LVGLA Sbjct: 373 QLSQEASDAEKARKVWELSEKLVGLA 398
>PORB_HORVU (Q42850) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 395 Score = 47.8 bits (112), Expect = 7e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLS+EASD EKARKVWELSE LVGLA Sbjct: 370 QLSEEASDTEKARKVWELSEKLVGLA 395
>POR_PEA (Q01289) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 399 Score = 47.8 bits (112), Expect = 7e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASD EKARKVWE+SE LVGLA Sbjct: 374 QLSQEASDAEKARKVWEVSEKLVGLA 399
>PORB_ARATH (P21218) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 401 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLS+EASD EKARKVWE+SE LVGLA Sbjct: 376 QLSEEASDVEKARKVWEISEKLVGLA 401
>POR_DAUCA (Q9SDT1) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLS+EASD EKARKVWE+SE LVGLA Sbjct: 373 QLSEEASDVEKARKVWEVSEKLVGLA 398
>PORA_ARATH (Q42536) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 405 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLSQEASD EKAR+VWE+SE LVGLA Sbjct: 380 QLSQEASDVEKARRVWEVSEKLVGLA 405
>PORC_ARATH (O48741) Protochlorophyllide reductase C, chloroplast precursor (EC| 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) Length = 401 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 QLS+EASD EKA+K+WE+SE LVGLA Sbjct: 376 QLSKEASDAEKAKKLWEVSEKLVGLA 401
>POR_MARPA (O80333) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 458 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGL 235 +LS+EAS+PEKA+++WELSE L GL Sbjct: 433 ELSEEASNPEKAKRLWELSERLSGL 457
>POR_PLEBO (O66148) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 +LS++ +D KA+++WELSE LVGLA Sbjct: 297 ELSEKVTDDAKAKRMWELSEKLVGLA 322
>POR_SYNY3 (Q59987) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 36.2 bits (82), Expect = 0.022 Identities = 14/25 (56%), Positives = 22/25 (88%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGL 235 +LS++ SD +KA+++W+LSE LVGL Sbjct: 297 ELSEQGSDAQKAQRMWDLSEKLVGL 321
>POR_CHLRE (Q39617) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 397 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGLA 232 Q+S+E +D KA K+W++S LVGL+ Sbjct: 371 QVSEEVADDSKASKLWDISAKLVGLS 396
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 107 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPD*G 3 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>RDH13_MOUSE (Q8CEE7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 334 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 303 SQEASDPEKARKVWELSENLVGLA*STANP 214 S EA D E AR++W S LVGLA + +P Sbjct: 297 SPEAEDEEVARRLWTESARLVGLAMAHGSP 326
>ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase ATXR3 (EC| 2.1.1.43) (Trithorax-related protein 3) (TRX-related protein 3) (Protein SET DOMAIN GROUP 2) Length = 2351 Score = 29.3 bits (64), Expect = 2.6 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 25 YYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKHDNYQISLKKRQVEHRPAS 192 Y S+ CRKL +RS+HS +SQ + E L R + + SL+K +H+ AS Sbjct: 322 YGSSKCRKLSDDCSRSLHSDHYSQHSA---ERLYRDSYPSKNSSLEKYPRKHQDAS 374
>WWOX_MOUSE (Q91WL8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 414 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 303 SQEASDPEKARKVWELSENLV 241 S+EA E AR +WELSE L+ Sbjct: 385 SEEAQSEETARALWELSERLI 405
>RDH14_HUMAN (Q9HBH5) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 336 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGL 235 +L +A D ARK+W++SE +VGL Sbjct: 310 ELLPKAMDESVARKLWDISEVMVGL 334
>RPOB_STRPM (Q48VR1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -3 Query: 253 RESRRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP6 (Q5XE97) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -3 Query: 253 RESRRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP3 (Q8K8W3) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -3 Query: 253 RESRRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>WWOX_BRARE (Q803A8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 412 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 303 SQEASDPEKARKVWELSENLV 241 S +A DP A +WELSE LV Sbjct: 382 SPQAQDPAAALSLWELSERLV 402
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 107 QERPCEWPRECIDLVWKMYNF 45 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112
>RDH14_MOUSE (Q9ERI6) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 334 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 309 QLSQEASDPEKARKVWELSENLVGL 235 +L +A D ARK+W++SE +VG+ Sbjct: 308 ELLPKAMDESVARKLWDISEVMVGI 332
>MDLB_PSEPU (P20932) L(+)-mandelate dehydrogenase (EC 1.-.-.-) (S-mandelate| dehydrogenase) (MDH) Length = 393 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 144 LPNKFKKTTS*ASAGVLDACMHP-WDLRWI 230 L N+FK S ++ VLD C+HP W L ++ Sbjct: 169 LHNRFKIPMSYSAKVVLDGCLHPRWSLDFV 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,549,487 Number of Sequences: 219361 Number of extensions: 754655 Number of successful extensions: 2176 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 2140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2176 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
