ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet98d08 |
|---|---|
| Clone Library Name | barley_pub |
>WRBA_METAC (P58796) Flavoprotein wrbA| Length = 209 Score = 41.2 bits (95), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPSE ELA+A +QG+++ KK+ Sbjct: 175 IAGGDGSRQPSENELAMARYQGRHVTLIAKKI 206
>WRBA_SHIFL (P0A8G8) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_SALTY (Q8ZQ40) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_SALTI (Q8Z7N9) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_SALPA (Q5PG91) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_ECOLI (P0A8G6) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_ECOL6 (P0A8G7) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_ECO57 (Q8X4B4) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 197 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS+ EL++A +QG+Y+A KL Sbjct: 164 IAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195
>WRBA_METMA (Q8PUV4) Flavoprotein wrbA| Length = 209 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPSE EL +A +QG+++ KK+ Sbjct: 175 IAGGDGSRQPSENELEMARYQGRHVTQIAKKI 206
>WRBA_YERPS (Q66BP3) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 199 Score = 37.7 bits (86), Expect = 0.012 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS ELA+A QG+++A KL Sbjct: 166 IAGGDGSRQPSAEELAIARFQGEHVAKITAKL 197
>WRBA_YERPE (Q8ZF61) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 199 Score = 37.7 bits (86), Expect = 0.012 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS ELA+A QG+++A KL Sbjct: 166 IAGGDGSRQPSAEELAIARFQGEHVAKITAKL 197
>WRBA_RHOPA (Q6NBB9) Flavoprotein wrbA| Length = 199 Score = 37.7 bits (86), Expect = 0.012 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPSE ELA A +QGK +A KL Sbjct: 166 ITGGDGSRQPSETELAGARYQGKTIAETAIKL 197
>WRBA_PHOLL (Q7N5I5) Flavoprotein wrbA (Trp repressor-binding protein)| Length = 199 Score = 36.6 bits (83), Expect = 0.027 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = -3 Query: 409 GDGSRQPSEAELALAEHQGKYMAAFVKKL 323 GDGSR P+E EL +A +QG+++A KKL Sbjct: 169 GDGSRIPNENELKIARYQGEHVAKIAKKL 197
>ALTA7_ALTAL (P42058) Minor allergen Alt a 7 (Alt a VII)| Length = 204 Score = 35.8 bits (81), Expect = 0.046 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -3 Query: 412 AGDGSRQPSEAELALAEHQGKYMAAFVKK 326 AGDGSRQPSE EL +A+ QGK V K Sbjct: 173 AGDGSRQPSELELNIAQAQGKAFYEAVAK 201
>WRBA_BRAJA (Q89D74) Flavoprotein wrbA| Length = 199 Score = 35.8 bits (81), Expect = 0.046 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS ELA A +QG+ +A +KL Sbjct: 166 ITGGDGSRQPSANELAGARYQGRQIAETARKL 197
>WRBA_CAUCR (Q9AA17) Flavoprotein wrbA| Length = 199 Score = 34.3 bits (77), Expect = 0.13 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPSE EL A +QG+ +A KL Sbjct: 166 IAGGDGSRQPSENELTGARYQGRKIAETAIKL 197
>WRBA_AGRT5 (P58795) Flavoprotein wrbA| Length = 199 Score = 34.3 bits (77), Expect = 0.13 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -3 Query: 409 GDGSRQPSEAELALAEHQGKYMAAFVKKL 323 GDGSRQPS EL A +QG ++A KL Sbjct: 169 GDGSRQPSAIELDAARYQGAHVAKLAAKL 197
>WRBA1_RHIME (Q92PU3) Flavoprotein wrbA 1| Length = 199 Score = 34.3 bits (77), Expect = 0.13 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + GDGSRQPS EL A QG ++A KL Sbjct: 166 ITGGDGSRQPSAVELEAARFQGAHVARIAAKL 197
>WRBA_ZYMMO (Q9XBR5) Flavoprotein wrbA| Length = 200 Score = 34.3 bits (77), Expect = 0.13 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + A DGSRQPS+ EL A+ GK++A KKL Sbjct: 166 IAASDGSRQPSKNELDGAKFLGKHVAELAKKL 197
>WRBA2_RHIME (Q930L2) Flavoprotein wrbA 2| Length = 202 Score = 34.3 bits (77), Expect = 0.13 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMA 341 V GDGSRQPS+ +LA A HQG+ +A Sbjct: 166 VAGGDGSRQPSQIDLAGAFHQGEIVA 191
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 32.7 bits (73), Expect = 0.39 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 369 SPSTRASTWPPS*RSSVMPDSEPADGPSIEPVSSQSASI 253 +P A PPS S V+P SEP PS PV S + S+ Sbjct: 462 APGPHAPLMPPSPPSQVLPASEPKRHPSTLPVISDARSV 500
>WRBA_GEOSL (Q74F05) Flavoprotein wrbA| Length = 203 Score = 32.0 bits (71), Expect = 0.67 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -3 Query: 418 VFAGDGSRQPSEAELALAEHQGKYMAAFVKKL 323 + G G R PSE +LA A QG+Y+A KL Sbjct: 170 IAGGQGERLPSENDLAGARFQGRYVAQIAAKL 201
>WRBA_BRUSU (Q8G0P0) Flavoprotein wrbA| Length = 199 Score = 31.6 bits (70), Expect = 0.87 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -3 Query: 409 GDGSRQPSEAELALAEHQGKYMAAFVKKL 323 GDGSRQPS EL A QG+ +A KL Sbjct: 169 GDGSRQPSAQELDGARFQGRRVAEITAKL 197
>WRBA_BRUME (Q8YH68) Flavoprotein wrbA| Length = 199 Score = 31.6 bits (70), Expect = 0.87 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -3 Query: 409 GDGSRQPSEAELALAEHQGKYMAAFVKKL 323 GDGSRQPS EL A QG+ +A KL Sbjct: 169 GDGSRQPSAQELDGARFQGRRVAEITAKL 197
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 30.8 bits (68), Expect = 1.5 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 369 SPSTRASTWPPS*RSSVMPDSEPADGPSIEPVSSQSASI 253 +P PPS S V+P SEP PS PV S + S+ Sbjct: 462 APGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSV 500
>PAWR_HUMAN (Q96IZ0) PRKC apoptosis WT1 regulator protein (Prostate apoptosis| response-4 protein) (Par-4) Length = 340 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -1 Query: 414 LLVMVAGSPARRNLRSPSTRASTWPPS*RSSVMPDSEPADGPSIEP 277 +L A P R P+ AS PP R PD P G S P Sbjct: 97 MLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGP 142
>ALGP_PSEAE (P15276) Transcriptional regulatory protein algP (Alginate| regulatory protein algR3) Length = 352 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/48 (25%), Positives = 27/48 (56%) Frame = -1 Query: 399 AGSPARRNLRSPSTRASTWPPS*RSSVMPDSEPADGPSIEPVSSQSAS 256 A PA + P +++ P+ + + P ++PA P+ +PV+++ A+ Sbjct: 263 AAKPAAKPAAKPVAKSAAAKPAAKPAAKPAAKPAAKPAAKPVAAKPAA 310
>K0552_HUMAN (O60299) Protein KIAA0552| Length = 673 Score = 28.1 bits (61), Expect = 9.7 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 224 EQAKLKRKQWMLADWLLTGSMDGPS-AGSESGMTELLHEGGHVLALVLGERKFR 382 ++AK++R+ + A L S+DG + AG ESG L E G + A + ER+ R Sbjct: 539 DEAKMRRQAGVAAAASLV-SVDGEAEAGGESGTRALRREVGRLQAELAAERRAR 591
>CLAH7_CLAHE (P42059) Minor allergen Cla h 7 (Cla h 5) (Cla h V)| Length = 204 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -3 Query: 409 GDGSRQPSEAELALAEHQGKYMAAFVKKL 323 GDGSRQPS+ EL L QGK V K+ Sbjct: 174 GDGSRQPSQKELELTA-QGKAFYEAVAKV 201
>POLG_TUMVJ (P89509) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3164 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = -3 Query: 427 WS*VFAGDG------SRQPSEAELALAEHQGKYMAAFVK 329 WS + DG SR PSEA + EH+GK A +K Sbjct: 312 WSGIVVRDGILTQKRSRSPSEAFVIRGEHEGKLYDARIK 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,010,925 Number of Sequences: 219361 Number of extensions: 1037934 Number of successful extensions: 2955 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 2852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2954 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
