ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet98d05 |
|---|---|
| Clone Library Name | barley_pub |
>THN7_HORVU (Q42838) Thionin BTH7 precursor [Contains: Thionin BTH7; Acidic| protein] Length = 137 Score = 112 bits (281), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 365 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA Sbjct: 87 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 137
>THN5_HORVU (P09617) Leaf-specific thionin precursor [Contains: Leaf-specific| thionin; Acidic protein] Length = 137 Score = 112 bits (281), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 365 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA Sbjct: 87 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 137
>THNX_HORVU (Q8H0Q5) Probable leaf thionin precursor [Contains: Probable leaf| thionin; Acidic protein] Length = 137 Score = 111 bits (278), Expect = 4e-25 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -1 Query: 365 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDG+VIQSVEA Sbjct: 87 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGDVIQSVEA 137
>THN3_HORVU (P08772) Leaf-specific thionin DB4 precursor [Contains:| Leaf-specific thionin DB4; Acidic protein] Length = 137 Score = 105 bits (261), Expect = 4e-23 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 365 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 T+YCTIGCR SVCDNMDNV RGQEMKFDMGLCSNACARFCNDG VIQSVEA Sbjct: 87 TQYCTIGCRNSVCDNMDNVFRGQEMKFDMGLCSNACARFCNDGAVIQSVEA 137
>THN6_HORVU (P09618) Leaf-specific thionin BTH6 precursor [Contains:| Leaf-specific thionin BTH6; Acidic protein] Length = 137 Score = 102 bits (255), Expect = 2e-22 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -1 Query: 365 TEYCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 T+YCTIGC SVCDNMDNV RGQEMKFDMGLCSNACARFCNDG VIQSVEA Sbjct: 87 TQYCTIGCTNSVCDNMDNVFRGQEMKFDMGLCSNACARFCNDGAVIQSVEA 137
>THN1_WHEAT (P01544) Alpha-1-purothionin precursor (Purothionin A-II)| [Contains: Alpha-1-purothionin; Acidic protein] (Fragment) Length = 126 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSR-GQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 EYC +GCR+SVCD M N + +EMK + C++AC FCN + S++A Sbjct: 75 EYCNLGCRSSVCDYMVNAAADDEEMKLYVENCADACVSFCNGDAGLPSLDA 125
>THN2_WHEAT (P32032) Alpha-2-purothionin precursor [Contains:| Alpha-2-purothionin; Acidic protein] Length = 136 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSR-GQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 EYC +GCR+SVCD M N + +EMK + C +AC FCN + S++A Sbjct: 86 EYCNLGCRSSVCDYMVNAAADDEEMKLYVENCGDACVNFCNGDAGLTSLDA 136
>THN5_WHEAT (Q05806) Type-5 thionin precursor [Contains: Type-5 thionin (Type V| thionin); Acidic protein] Length = 131 Score = 49.3 bits (116), Expect = 2e-06 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSRG--QEMKFDMGLCSNACARFCNDGEVIQSVE 216 EYC++GCR+SVCDNM N + +EMK + C AC FC ++ S++ Sbjct: 80 EYCSLGCRSSVCDNMINTADNSTEEMKLYVKRCGVACDSFCKGDTLLASLD 130
>THNB_WHEAT (P01543) Purothionin A-1 precursor (Purothionin A-I)| (Beta-purothionin) [Contains: Purothionin A-1; Acidic protein] Length = 136 Score = 48.1 bits (113), Expect = 5e-06 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSR-GQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 EYC +GCR+S+CD + N + +EMK + C +AC FCN + S++A Sbjct: 86 EYCNLGCRSSLCDYIVNAAADDEEMKLYVEQCGDACVNFCNADAGLTSLDA 136
>THNB_HORVU (P21742) Beta-hordothionin precursor [Contains: Beta-hordothionin;| Acidic protein] Length = 136 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSR-GQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 +YC +GCR S+CD M N + +EMK + CS+AC FCN + S+ A Sbjct: 86 DYCNLGCRASMCDYMVNAAADDEEMKLYVEHCSDACVNFCNGDVGLTSLTA 136
>THNA_HORVU (P01545) Alpha-hordothionin precursor (Purothionin II) [Contains:| Alpha-hordothionin; Acidic protein] Length = 127 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSR-GQEMKFDMGLCSNACARFCNDGEVIQSVEA 213 +YC +GCR S+CD M N + +EMK + C +AC FCN + S+ A Sbjct: 77 KYCNLGCRASMCDYMVNAAADDEEMKLYLENCGDACVNFCNGDAGLTSLTA 127
>THN_BRARP (Q9SBK8) Thionin precursor [Contains: Thionin; Acidic protein]| Length = 133 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSRGQEMKFD--MGLCSNACARFCNDG 237 EYC +GC +SVC + + ++ + + C+NAC+ FC G Sbjct: 82 EYCKLGCASSVCGALTTLKNSMQVNCEGAVSQCTNACSNFCTKG 125
>THN21_ARATH (Q42596) Thionin-2.1 precursor [Contains: Thionin-2.1; Acidic| protein] Length = 134 Score = 35.0 bits (79), Expect = 0.045 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -1 Query: 362 EYCTIGCRTSVCDNMDNVSRGQEMKFDMGL---CSNACARFCNDGEVI 228 E+C +GC TSVC M+ + + G C+ C+ FC V+ Sbjct: 79 EHCKLGCETSVCGAMNTLQNSDASEIVNGASEQCAKGCSIFCTKSYVV 126
>THN24_ARATH (Q9C8D6) Probable thionin-2.4 precursor [Contains: Probable| thionin-2.4; Acidic protein] Length = 134 Score = 33.9 bits (76), Expect = 0.100 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -1 Query: 365 TEYCTIGCRTSVCDN---MDNVSRGQEMKFDMGLCSNACARFCNDGEV 231 TEYC +GC +SVC + N + + ++ C+ AC+ C G + Sbjct: 81 TEYCKLGCVSSVCGALTILQNSDASEIVNGEVEKCTMACSTVCTKGSM 128
>TOP1_METJA (Q59046) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 761 Score = 33.1 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 28 ILSQGYK*IHRGDSYWNEGKNRNT*LHHHYRK*QNDLGIKIVEQKMTKR 174 +L K IH + +WNE + +N Y K +++ K+VE K TKR Sbjct: 229 LLKDNLKAIHEKEKFWNEKEAKNV-----YEKIKDEKSAKVVEIKKTKR 272
>THN22_ARATH (Q42597) Thionin-2.2 precursor [Contains: Thionin-2.2; Acidic| protein] Length = 134 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -1 Query: 362 EYCTIGCRTSVC---DNMDNVSRGQEMKFDMGLCSNACARFCNDG 237 EYC +GC +SVC + N + + + C+ AC+ C G Sbjct: 82 EYCKLGCASSVCGALTTLQNFDTSKVLSEAVEQCTKACSSVCTGG 126
>THNB_VISAL (P08943) Viscotoxin B precursor [Contains: Viscotoxin B; Acidic| protein] (Fragment) Length = 103 Score = 31.2 bits (69), Expect = 0.65 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 359 YCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCNDG 237 YCT+GC++S C ++ E+ + C AC+ C+ G Sbjct: 54 YCTLGCQSSKCASI-TTPPNSEVDAEAVRCKAACSNLCDFG 93
>NPT2B_RAT (Q9JJ09) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 me Length = 695 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 266 CCRVPCRISSLGHGKHCPCCHXRKSCIQL 352 CCRV CR+ + G C CC K C L Sbjct: 621 CCRVCCRVCCMVCG--CKCCRCSKCCKNL 647
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 266 CCRVPCRISSLGHGKHCPCCHXRKSC 343 CCRV CR+ + G C CC K C Sbjct: 621 CCRVCCRVCCMVCG--CKCCRCSKCC 644
>THN23_ARATH (Q8VZK8) Probable thionin-2.3 precursor [Contains: Probable| thionin-2.3; Acidic protein] Length = 135 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 359 YCTIGCRTSVC---DNMDNVSRGQEMKFDMGLCSNACARFCNDG 237 YC +GC +S+C ++ + ++ + C+ AC+ C G Sbjct: 84 YCKLGCVSSLCGALTSLQKLDTSGKVNVAVERCTKACSTICTKG 127
>THN3_VISAL (P01538) Viscotoxin A3 precursor [Contains: Viscotoxin A3; Acidic| protein] Length = 111 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 359 YCTIGCRTSVCDNMDNVSRGQEMKFDMGLCSNACARFCND 240 YCT+GC +S C N + C AC+ C D Sbjct: 74 YCTLGCESSQCATNSNGDA------EAVRCKTACSDLCQD 107
>RLP7_KLULA (P32102) Ribosome biogenesis protein RLP7| Length = 318 Score = 28.9 bits (63), Expect = 3.2 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +2 Query: 47 NRFIVA-TLIGTREKTEIHNFTIITENDKTTL--VSRLLNRK*QNDLGHRNHAQEGMIRL 217 NRF+ A T++ T T+ TE +KT + V L N+K +NDL H ++ ++R+ Sbjct: 46 NRFVRAETIVAT---------TLATEREKTRIRRVRDLENQKVKNDLSHIPSDRDFILRI 96 Query: 218 QQTE 229 + E Sbjct: 97 SERE 100
>SP63_STRPU (Q07929) 63 kDa sperm flagellar membrane protein precursor| Length = 470 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = -1 Query: 353 TIGCRTSVCDNMDNVSRGQEMKF---DMGLCSNACARFCNDGEVIQSVEA*SCLLGHDFY 183 T C T + DN N + D GLC+ CN+G I+ C+ G+D+ Sbjct: 228 TCECDTELYDNSPNTEEPGRVCIAPCDPGLCTRP-NEICNNGGTIEDDNLCKCIEGYDYT 286 Query: 182 GQG 174 G Sbjct: 287 QYG 289
>COPB2_MOUSE (O55029) Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP)| (p102) Length = 905 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 9/42 (21%) Frame = -2 Query: 136 GRFVIFCNDGEVMYFCFFPRSNKS---------RHDESIYTL 38 GRFV+ C DGE + + NKS HD S Y + Sbjct: 364 GRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAI 405
>COPB2_HUMAN (P35606) Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP)| (p102) Length = 905 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 9/42 (21%) Frame = -2 Query: 136 GRFVIFCNDGEVMYFCFFPRSNKS---------RHDESIYTL 38 GRFV+ C DGE + + NKS HD S Y + Sbjct: 363 GRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAI 404
>COPB2_BOVIN (P35605) Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP)| (p102) Length = 905 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 9/42 (21%) Frame = -2 Query: 136 GRFVIFCNDGEVMYFCFFPRSNKS---------RHDESIYTL 38 GRFV+ C DGE + + NKS HD S Y + Sbjct: 363 GRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAI 404
>COPB2_RAT (O35142) Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP)| (p102) Length = 904 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 9/42 (21%) Frame = -2 Query: 136 GRFVIFCNDGEVMYFCFFPRSNKS---------RHDESIYTL 38 GRFV+ C DGE + + NKS HD S Y + Sbjct: 363 GRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAI 404
>YCBO_BACSU (P42247) Hypothetical protein ycbO| Length = 204 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 189 FLWPRSFCHFLFNNLDTKVVLSFSVMMVKLCISVF-----SLVPI 70 F W S CHF+ L ++++ S VK+ + F SLVPI Sbjct: 101 FFWLNSICHFIPGELTSEII---SQQAVKMAVFAFGAAGTSLVPI 142
>TNR4_MOUSE (P47741) Tumor necrosis factor receptor superfamily member 4| precursor (OX40L receptor) (OX40 antigen) Length = 272 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 239 HHYRNGHMRCCRVPCRISSLGHGKHCPCCHXRKSCIQLCST 361 H Y +GH +CCR C+ GHG C H R + C T Sbjct: 30 HTYPSGH-KCCR-ECQP---GHGMVSRCDHTRDTLCHPCET 65
>TRI42_HUMAN (Q8IWZ5) Tripartite motif protein 42| Length = 723 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 314 CPCCHXRKSCIQLCS 358 CPCC ++ C QLCS Sbjct: 9 CPCCTWQRCCPQLCS 23
>ENGA_LACDE (Q8KH12) Probable GTP-binding protein engA| Length = 435 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 130 FVIFCNDGEVMYFCF 86 FV+FCND E+M+F + Sbjct: 394 FVVFCNDPELMHFSY 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,685,334 Number of Sequences: 219361 Number of extensions: 1081956 Number of successful extensions: 2572 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 2513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2563 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
