Clone Name | rbaet98b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 28 | 4.8 |
---|
>MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 434 Score = 28.5 bits (62), Expect = 4.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 18 H*VTIGSYFTNHQVPAALLCDRTSIIIN-KGSLRYPLIHHSSYKTKARSLHG 170 H + + F + P + D + N + +L Y + H SSY KA SLHG Sbjct: 173 HYIQTKNSFFDDSTPKLINKDESKAKFNLQNALSYGIEHPSSYHVKAYSLHG 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,342,441 Number of Sequences: 219361 Number of extensions: 497270 Number of successful extensions: 1009 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1009 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)