Clone Name | rbaet98b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 0.94 | 2 | NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.... | 28 | 6.1 |
---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.94 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 254 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 138 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.99.5) (NADH| dehydrogenase I, chain A) (NDH-1, chain A) Length = 132 Score = 28.1 bits (61), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 115 WGFLAFFFVVIKTCVIMIML 56 W F FFF+ + CV M+ + Sbjct: 12 WAFFTFFFIAVSICVFMLSI 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,070,862 Number of Sequences: 219361 Number of extensions: 765440 Number of successful extensions: 1834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1829 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)