| Clone Name | rbaet98a10 |
|---|---|
| Clone Library Name | barley_pub |
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 33.5 bits (75), Expect = 0.20 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQYILRAAAIKALG Sbjct: 260 YHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 33.1 bits (74), Expect = 0.27 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQY+LRAAAIKALG Sbjct: 260 YHQYVLRAAAIKALG 274
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 32.3 bits (72), Expect = 0.45 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQYILRA+AIKALG Sbjct: 258 YHQYILRASAIKALG 272
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 32.0 bits (71), Expect = 0.59 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQ+ILRAAAIKALG Sbjct: 265 YHQFILRAAAIKALG 279
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 32.0 bits (71), Expect = 0.59 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQYILRA AIKALG Sbjct: 270 YHQYILRAGAIKALG 284
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 418 YHQYILRAAAIKAL 377 YHQYILRAAAIKAL Sbjct: 256 YHQYILRAAAIKAL 269
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 1.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 418 YHQYILRAAAIKALG 374 YHQ++LRA AIKALG Sbjct: 264 YHQFVLRAGAIKALG 278
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 2.9 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 368 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 222 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 6.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 205 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 321 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,412,841 Number of Sequences: 219361 Number of extensions: 998441 Number of successful extensions: 2448 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2447 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)