Clone Name | rbaet95h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VDAC_MAIZE (P42057) Outer plastidial membrane protein porin (Vol... | 28 | 5.6 | 2 | TRI66_HUMAN (O15016) Tripartite motif protein 66 | 27 | 9.5 | 3 | PPCS_MOUSE (Q8VDG5) Phosphopantothenate--cysteine ligase (EC 6.3... | 27 | 9.5 |
---|
>VDAC_MAIZE (P42057) Outer plastidial membrane protein porin (Voltage-dependent| anion-selective channel protein) (VDAC) Length = 277 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 341 HLWHPTSYLILIGSSELNLHNRSSAVGLS*LLGH 240 H W P S++ + G + +S+ VGLS +L H Sbjct: 244 HEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLKH 277
>TRI66_HUMAN (O15016) Tripartite motif protein 66| Length = 1214 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 241 CPNNQERPTAEDLLCKFSSEDPIKI 315 CP + P+ E+ LCK E+PI + Sbjct: 780 CPRDGADPSLENALCKVKLEEPINL 804
>PPCS_MOUSE (Q8VDG5) Phosphopantothenate--cysteine ligase (EC 6.3.2.5)| (Phosphopantothenoylcysteine synthetase) (PPC synthetase) Length = 311 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 20 VLITIYGMKWPLQSKGISLVAQHPFGSRG*ANASTNLAS 136 VLIT G K PL+++ + + G RG A+A LA+ Sbjct: 38 VLITSGGTKVPLEARAVRFLDNFSSGRRGAASAEVFLAA 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,545,779 Number of Sequences: 219361 Number of extensions: 924825 Number of successful extensions: 1730 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1730 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)