Clone Name | rbaet95h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EXOC1_DROME (Q9VVG4) Probable exocyst complex component 1 (Exocy... | 29 | 2.5 | 2 | COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 28 | 4.3 | 3 | NLTP_RABIT (O62742) Nonspecific lipid-transfer protein, mitochon... | 28 | 5.6 |
---|
>EXOC1_DROME (Q9VVG4) Probable exocyst complex component 1 (Exocyst complex| component Sec3) Length = 889 Score = 29.3 bits (64), Expect = 2.5 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -3 Query: 176 SVYTAEK*RGKQSAGPCLLASAPPFPSLVAPLLLCSETRQ-EQKQENKKM*SMMRW*SG 3 SV T K + K+ C++ +APP P + L+ SE R+ E K++ ++W G Sbjct: 28 SVVTVVKKKDKKPCYLCVVTTAPPVPVVTLCLIKQSEQREGEYKRKRSWQLDEIKWVDG 86
>COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 549 Score = 28.5 bits (62), Expect = 4.3 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 13 HLIIDYIFLFSCFC 54 H+++DY+FL CFC Sbjct: 519 HIVLDYLFLILCFC 532
>NLTP_RABIT (O62742) Nonspecific lipid-transfer protein, mitochondrial| precursor (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCP-chi) (SCPX) Length = 547 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 22 IDYIFLFSCFCS*RVSEHRRRGATREGKGGALASK 126 ID I L CF + + + G EGKGGAL + Sbjct: 299 IDVIELHDCFSANELLTYEALGLCPEGKGGALVDR 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,283,532 Number of Sequences: 219361 Number of extensions: 352105 Number of successful extensions: 853 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)