Clone Name | rbaet95h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FLT3L_MOUSE (P49772) SL cytokine precursor (Fms-related tyrosine... | 32 | 0.74 | 2 | CT103_HUMAN (Q9UJQ1) Protein C20orf103 precursor | 29 | 4.8 | 3 | CT103_PONPY (Q5R5V2) Protein C20orf103 homolog precursor | 29 | 4.8 |
---|
>FLT3L_MOUSE (P49772) SL cytokine precursor (Fms-related tyrosine kinase 3| ligand) (Flt3 ligand) (Flt3L) Length = 232 Score = 32.0 bits (71), Expect = 0.74 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 148 FVTRAPAQLIPWCLAFINSNQNLLVHDHCTKVVCL 44 FVT Q +P CL F+ +N + L+ D CT+++ L Sbjct: 108 FVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLAL 142
>CT103_HUMAN (Q9UJQ1) Protein C20orf103 precursor| Length = 280 Score = 29.3 bits (64), Expect = 4.8 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 434 RLIIFMMRQVAQRHRTQRLQSPSGMSGNPEEDYAVSGGGANGTT 303 R+++ + +AQ Q +++ SG+S NPE+D V NGTT Sbjct: 15 RVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVV--RENGTT 56
>CT103_PONPY (Q5R5V2) Protein C20orf103 homolog precursor| Length = 223 Score = 29.3 bits (64), Expect = 4.8 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 434 RLIIFMMRQVAQRHRTQRLQSPSGMSGNPEEDYAVSGGGANGTT 303 R+++ + +AQ Q +++ SG+S NPE+D V NGTT Sbjct: 15 RVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVV--RENGTT 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,459,342 Number of Sequences: 219361 Number of extensions: 1110955 Number of successful extensions: 3266 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3265 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)