Clone Name | rbaet95g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NPRV_VIBPR (Q00971) Neutral protease precursor (EC 3.4.24.25) (V... | 28 | 6.8 | 2 | SYH_YEAST (P07263) Histidyl-tRNA synthetase, mitochondrial precu... | 28 | 6.8 | 3 | RGA2_YEAST (Q06407) Rho-type GTPase-activating protein 2 | 27 | 8.9 |
---|
>NPRV_VIBPR (Q00971) Neutral protease precursor (EC 3.4.24.25) (Vibriolysin)| (Aeromonolysin) Length = 609 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 60 TPRLLQPSTRHHSGSNRENKKWNKSS 137 TP Q + R H G+N EN WN SS Sbjct: 297 TPLTFQLTMRVHYGNNYENAFWNGSS 322
>SYH_YEAST (P07263) Histidyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.21) (Histidine--tRNA ligase) (HisRS) Length = 546 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 88 LVDGCSSRGVKDFKCELNKNSL 23 LV+G +S G+KDFK +LN + Sbjct: 194 LVEGLTSLGIKDFKIKLNHRKI 215
>RGA2_YEAST (Q06407) Rho-type GTPase-activating protein 2| Length = 1009 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +3 Query: 12 STRGREFLFNSHLKSLTPRLLQPSTRHHSGSNRE---NKKWNKSSAQEPVFK 158 S + + F+ N LKS T +L P HHS S +E + W SS + K Sbjct: 435 SLKSKNFVHN--LKSKTSEMLDPKHPHHSTSIQESDTHSGWGVSSTHTNIRK 484 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,187,557 Number of Sequences: 219361 Number of extensions: 486896 Number of successful extensions: 1040 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)