ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet95g03 |
|---|---|
| Clone Library Name | barley_pub |
>ACT3_ORYSA (P17299) Actin-3| Length = 377 Score = 87.8 bits (216), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377
>ACT2_DAUCA (P23344) Actin-2| Length = 381 Score = 87.8 bits (216), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 342 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 381
>ACT3_SOYBN (P02580) Actin-3| Length = 376 Score = 87.8 bits (216), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 376
>ACT13_SOLTU (P30173) Actin-101| Length = 377 Score = 86.7 bits (213), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+KGEYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKGEYDESGPSIVHRKCF 377
>ACT12_SOLTU (P30172) Actin-100 (Fragment)| Length = 357 Score = 86.7 bits (213), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+KGEYDESGPSIVHRKCF Sbjct: 318 KYSVWIGGSILASLSTFQQMWITKGEYDESGPSIVHRKCF 357
>ACT7_ARATH (P53492) Actin-7 (Actin-2)| Length = 377 Score = 85.5 bits (210), Expect = 5e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKCF 377
>ACT_COSCS (P30161) Actin (Fragment)| Length = 331 Score = 85.5 bits (210), Expect = 5e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 292 KYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 331
>ACT_FUCDI (P53502) Actin| Length = 375 Score = 85.5 bits (210), Expect = 5e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 375
>ACT_FUCVE (Q39758) Actin| Length = 376 Score = 85.5 bits (210), Expect = 5e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 376
>ACT_PUCGR (P50138) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT_NEUCR (P78711) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT_GAEGA (Q6TCF2) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT_EXODE (Q8X119) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT_BOTCI (O13419) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT_AJECA (P53455) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_TRIVU (P63257) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_RAT (P63259) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_PENCH (Q9URS0) Actin, gamma| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_MOUSE (P63260) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_HUMAN (P63261) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_EMENI (P20359) Actin, gamma| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_CEPAC (Q9UVW9) Actin, gamma| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_BOVIN (P63258) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTG_ANSAN (P63256) Actin, cytoplasmic 2 (Gamma-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTC_STYPL (Q00215) Actin, cytoplasmic| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTC_BRALA (O17503) Actin, cytoplasmic| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTC_BRAFL (Q93131) Actin, cytoplasmic (BfCA1)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTC_BRABE (Q93129) Actin, cytoplasmic (BbCA1)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_XENLA (O93400) Actin, cytoplasmic 1 (Beta-actin) (Cytoplasmic beta actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_TRIVU (P60707) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_SIGHI (Q91ZK5) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_SHEEP (P60713) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_SALSA (O42161) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_RAT (P60711) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_RABIT (P29751) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_PANTR (Q5R1X3) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_ORYLA (P79818) Actin, cytoplasmic 1 (Beta-actin) (OlCA1)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_OREMO (P68143) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_MOUSE (P60710) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_MESAU (Q711N9) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_HUMAN (P60709) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_HORSE (P60708) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CYPCA (P83750) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CTEID (P83751) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CHICK (P60706) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CERAE (Q76N69) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CAVPO (Q71FK5) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CANFA (O18840) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_CAMDR (P84336) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB_BOVIN (P60712) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB2_BRARE (Q7ZVF9) Actin, cytoplasmic 2 (Beta-actin-2)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTB1_BRARE (Q7ZVI7) Actin, cytoplasmic 1 (Beta-actin-1)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACTA_PHYPO (P02576) Actin, plasmodial isoform| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT8_DICDI (P07830) Actin-15 (Actin A8) (Actin-1/100/103)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT3_FUGRU (P53486) Actin, cytoplasmic 3 (Beta-actin-3)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT3_DICDI (P07829) Actin-3-sub 1| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT2_FUGRU (P53485) Actin, cytoplasmic 2 (Beta-actin-2)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT2_DICDI (P07827) Actin A12| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT1_FUGRU (P68142) Actin, cytoplasmic 1 (Beta-actin-1)| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>ACT1_DICDI (P02577) Actin| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT1_ACACA (P02578) Actin-1| Length = 375 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 375
>ACT3_ARTSX (P18602) Actin, clone 302 (Fragment)| Length = 327 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 288 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 327
>ACTM_LYTPI (Q25381) Actin, muscle (LPM) (Fragment)| Length = 172 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 133 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 172
>ACT3_LYTPI (Q25379) Actin, cytoskeletal 3 (LPC3) (Fragment)| Length = 172 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 133 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 172
>ACT_PLAMG (Q26065) Actin, adductor muscle| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT_HYDAT (P17126) Actin, non-muscle 6.2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT_CRAGI (O17320) Actin| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTY_LIMPO (P41341) Actin-11| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTM_PISOC (P12717) Actin, muscle| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTM_HELTB (P53464) Actin, cytoskeletal (M)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTM_HELER (P53463) Actin, cytoskeletal (M)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTM_APLCA (P17304) Actin, muscle| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTF_STRPU (P18499) Actin, cytoskeletal IIIB| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTE_STRPU (P53474) Actin, cytoskeletal IIIA| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTD_STRPU (P69005) Actin, cytoskeletal IIB| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_STRPU (Q07903) Actin, cytoskeletal IIA| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_PISOC (P12716) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_HELTI (Q964D9) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_HALRO (P53461) Actin, nonmuscle| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_BIOTE (Q964E0) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_BIOPF (Q964E2) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_BIOOB (Q964E1) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_BIOGL (P92179) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTC_BIOAL (Q964E3) Actin, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTA_STRPU (P53472) Actin, cytoskeletal IA| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACTA_LIMPO (P41339) Actin, acrosomal process isoform (Actin-5)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT8_XENLA (P53506) Actin, cytoplasmic type 8| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT5_XENLA (P53505) Actin, cytoplasmic type 5| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT5_CHICK (P53478) Actin, cytoplasmic type 5| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT5C_ANOGA (P84185) Actin-5C (Actin-1D, cytoplasmic)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT4_CAEEL (P10986) Actin-4| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT4_BOMMO (P84183) Actin, cytoplasmic A4| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT4_ARTSX (P18603) Actin, clone 403| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT3_PODCA (P41113) Actin-3| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT3_LIMPO (P41340) Actin-3| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT3_BOMMO (P04829) Actin, cytoplasmic A3| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT3B_HELAM (P84184) Actin-A3b, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT3A_HELAM (Q25010) Actin, cytoplasmic A3a| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_STRFN (P69004) Actin-15B| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_SACKO (O18500) Actin-2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_ONCVO (P30163) Actin-2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_LYTPI (P53466) Actin, cytoskeletal 2 (LPC2)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_LUMTE (P92176) Actin-2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_DROME (P02572) Actin-42A| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_CAEEL (P10984) Actin-2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_STRFN (P10990) Actin-15A| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_SACKO (O18499) Actin-1| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_PODCA (P41112) Actin-1/2| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_LYTPI (P53465) Actin, cytoskeletal 1 (LPC1)| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_LUMTE (P92182) Actin-1| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_HELTB (P69003) Actin CyI, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_HELER (P69002) Actin CyI, cytoplasmic| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_DROME (P10987) Actin-5C| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT1_CAEEL (P10983) Actin-1/3| Length = 376 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_ABSGL (P26197) Actin-2| Length = 377 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377
>ACT_LUMRU (P91754) Actin (Fragment)| Length = 372 Score = 84.7 bits (208), Expect = 9e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 333 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 372
>ACT_SCHDU (O65314) Actin| Length = 378 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 378
>ACT_THELA (P10365) Actin| Length = 375 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMW+SK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWVSKQEYDESGPSIVHRKCF 375
>ACT_CRYNV (P48465) Actin| Length = 375 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 375
>ACT_ACHBI (P26182) Actin| Length = 376 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWISKAEYDESGPSIVHRKCF 376
>ACT_VOLCA (P20904) Actin| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 377
>ACT_GOSHI (O81221) Actin| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT_COLSC (O65315) Actin| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 377
>ACT_CHLRE (P53498) Actin| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 377
>ACT6_SOLTU (P30168) Actin-71| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT4_ARATH (P53494) Actin-4| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT3_SOLTU (P30167) Actin-58| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT3_PEA (P46258) Actin-3| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT1_TOBAC (Q05214) Actin| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT1_SORBI (P53504) Actin-1| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT1_ORYSA (P13362) Actin-1| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT1_ARATH (P10671) Actin-1/3| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT12_ARATH (P53497) Actin-12| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT11_SOLTU (P30171) Actin-97| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACT11_ARATH (P53496) Actin-11| Length = 377 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
>ACTT_FUGRU (P53482) Actin, alpha skeletal muscle 2| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTS_OREMO (P68264) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTS_FUGRU (P68140) Actin, alpha skeletal muscle 1| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTC_RAT (P68035) Actin, alpha cardiac (Alpha-cardiac actin)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTC_MOUSE (P68033) Actin, alpha cardiac (Alpha-cardiac actin)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTC_HUMAN (P68032) Actin, alpha cardiac (Alpha-cardiac actin)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTC_FUGRU (P53480) Actin, alpha cardiac| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTC_CHICK (P68034) Actin, alpha cardiac (Alpha-cardiac actin)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_RAT (P62738) Actin, aortic smooth muscle (Alpha-actin-2)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_RABIT (P62740) Actin, aortic smooth muscle (Alpha-actin-2)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_MOUSE (P62737) Actin, aortic smooth muscle (Alpha-actin-2)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_HUMAN (P62736) Actin, aortic smooth muscle (Alpha-actin-2)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_CHICK (P08023) Actin, aortic smooth muscle (Alpha-actin)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTA_BOVIN (P62739) Actin, aortic smooth muscle (Alpha-actin-2)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACT3_DIPDE (P53457) Actin-3| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 377
>ACT1_XENLA (P04751) Actin, alpha cardiac muscle (Actin alpha 1)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACT1_ORYLA (Q98972) Actin, muscle-type (OlMA1)| Length = 377 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
>ACTN_STYCL (P53475) Actin, muscle| Length = 378 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378
>ACTM_STYCL (P26198) Actin, muscle| Length = 378 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378
>ACT2_MOLOC (Q25472) Actin, muscle-type (A2)| Length = 378 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWITKQEYDESGPSIVHRKCF 378
>ACT2_HALRO (P27130) Actin, muscle 2/4/4A| Length = 378 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378
>ACTB_CRIGR (P48975) Actin, cytoplasmic 1 (Beta-actin)| Length = 375 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ+MWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQEMWISKQEYDESGPSIVHRKCF 375
>ACT1_ECHGR (P35432) Actin-1| Length = 375 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWITKQEYDESGPSIVHRKCF 375
>ACTH_RAT (P63269) Actin, gamma-enteric smooth muscle (Smooth muscle gamma| actin) (Alpha-actin-3) Length = 376 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
>ACTH_MOUSE (P63268) Actin, gamma-enteric smooth muscle (Smooth muscle gamma| actin) (Alpha-actin-3) Length = 376 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
>ACTH_HUMAN (P63267) Actin, gamma-enteric smooth muscle (Smooth muscle gamma| actin) (Alpha-actin-3) Length = 376 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
>ACTH_CHICK (P63270) Actin, gamma-enteric smooth muscle (Smooth muscle gamma| actin) (Alpha-actin-3) Length = 376 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
>ACT1_PEA (P30164) Actin-1| Length = 376 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKAEYDERGPSIVHRKCF 376
>ACT5_DIPDE (P53458) Actin-5 (Fragment)| Length = 371 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 332 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 371
>ACT_TAESO (P68555) Actin| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT_MAYDE (O16808) Actin| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
>ACT_MANSE (P49871) Actin, muscle| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
>ACT_BRUMA (P90689) Actin| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT6_DROSI (P83968) Actin, indirect flight muscle (Actin-88F)| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT6_DROME (P83967) Actin, indirect flight muscle (Actin-88F)| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT5_DROME (P10981) Actin-87E| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT5_BACDO (P45887) Actin-5, muscle-specific| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT4_DROME (P02574) Actin, larval muscle (Actin-79B)| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT3_DROME (P53501) Actin-57B| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
>ACT3_BACDO (P45886) Actin-3, muscle-specific| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT2_SCHMA (P53471) Actin-2| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT2_DIPDE (P53456) Actin-2| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT2_BOMMO (P07837) Actin, muscle A2| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT2_BACDO (P45885) Actin-2, muscle-specific| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
>ACT2_ARTSX (P18601) Actin, clone 211| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT1_SCHMA (P53470) Actin-1| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT1_ONCVO (P30162) Actin-1| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQ+WISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQVWISKQEYDESGPSIVHRKCF 376
>ACT1_DIPDE (P68556) Actin-1/4| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT1_BOMMO (P07836) Actin, muscle A1| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
>ACT1_BACDO (P83969) Actin, indirect flight muscle| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT1_ARTSX (P18600) Actin, clone 205| Length = 376 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
>ACT_CYAME (P53500) Actin| Length = 377 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE GPS+VHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKAEYDEFGPSVVHRKCF 377
>ACT8_ARATH (Q96293) Actin-8| Length = 377 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377
>ACT7_SOLTU (P30169) Actin-75| Length = 377 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K E+DESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEFDESGPSIVHRKCF 377
>ACT2_ARATH (Q96292) Actin-2| Length = 377 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377
>ACT1_MAIZE (P02582) Actin-1| Length = 375 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISKGEYDE+GP IVH KCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKGEYDETGPGIVHMKCF 375
>ACT_PICAN (O74258) Actin| Length = 376 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHHKCF 376
>ACT_CANDU (Q9UVZ8) Actin| Length = 376 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHHKCF 376
>ACT_CANAL (P14235) Actin| Length = 376 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHHKCF 376
>ACTS_RAT (P68136) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_RABIT (P68135) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_PIG (P68137) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_MOUSE (P68134) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_HUMAN (P68133) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_CYPCA (P53479) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_CHICK (P68139) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_CARAU (P49055) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_BOVIN (P68138) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_ATRMM (Q90X97) Actin, alpha skeletal muscle (Alpha-actin-1)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACT3_XENLA (P04752) Actin, alpha sarcomeric/skeletal (Actin alpha 3)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACT2_XENTR (P20399) Actin, alpha sarcomeric/cardiac (Actin alpha 2)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACT2_XENLA (P10995) Actin, alpha sarcomeric/cardiac (Actin alpha 2)| Length = 377 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
>ACTS_PLEWA (P10994) Actin, alpha skeletal muscle (Fragment)| Length = 125 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 86 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 125
>ACTM_CIOSA (O15998) Actin, muscle| Length = 378 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 378
>ACT1_HALRO (P53460) Actin, muscle 1A| Length = 378 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 378
>ACT1_PLABA (Q4Z1L3) Actin-1 (Actin I)| Length = 375 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 375
>ACT_TOXGO (P53476) Actin| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
>ACT_CRYPV (P26183) Actin| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
>ACTB_XENBO (P15475) Actin, cytoplasmic 1 (Beta actin)| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILA LSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILALLSTFQQMWISKQEYDESGPSIVHRKCF 376
>ACT2_PEA (P30165) Actin-2| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 +YSVWIGGSILASLSTFQQMWISK EYDE GPSIVHRKCF Sbjct: 337 RYSVWIGGSILASLSTFQQMWISKAEYDERGPSIVHRKCF 376
>ACT1_PLAYO (Q7RME1) Actin-1 (Actin I)| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
>ACT1_PLAFA (P10988) Actin-1 (Actin I)| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
>ACT1_PLAF7 (Q8I4X0) Actin-1 (Actin I)| Length = 376 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
>ACT6_DIPDE (P53459) Actin-6 (Fragment)| Length = 373 Score = 82.0 bits (201), Expect = 6e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 334 KYSVWIGGSILGSLSTFQQMWITKQEYDESGPSIVHRKCF 373
>ACT_PINCO (P24902) Actin (Fragment)| Length = 161 Score = 82.0 bits (201), Expect = 6e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWI+K EY+ESGPSIVHRKCF Sbjct: 122 KYSVWIGGSILASLSTFQQMWIAKTEYEESGPSIVHRKCF 161
>ACT1_PHYIN (P22131) Actin-1| Length = 376 Score = 82.0 bits (201), Expect = 6e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSI +SLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSIQSSLSTFQQMWISKAEYDESGPSIVHRKCF 376
>ACT_MESVI (O65316) Actin| Length = 377 Score = 82.0 bits (201), Expect = 6e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ MWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQAMWIAKSEYDESGPSIVHRKCF 377
>ACT_YEAST (P60010) Actin| Length = 375 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 336 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375
>ACT_SACBA (P60011) Actin| Length = 375 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 336 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375
>ACT_PHARH (P53689) Actin| Length = 375 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ MWISK EYDE+GPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQSMWISKQEYDEAGPSIVHRKCF 375
>ACT_CANGA (P60009) Actin| Length = 375 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 336 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375
>ACT2_PHYIN (P22132) Actin-2| Length = 375 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQ MWISK EYDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLATFQHMWISKTEYDESGPSIVHRKCF 375
>ACT3_ECHGR (Q03342) Actin-3 (Fragment)| Length = 309 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTF +MWISK EYDESGPSIVHRKCF Sbjct: 270 KYSVWIGGSILASLSTFHEMWISKQEYDESGPSIVHRKCF 309
>ACT_TRIRE (Q99023) Actin| Length = 376 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 376
>ACT_ASHGO (Q75D00) Actin| Length = 376 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 376
>ACT7_ORYSA (P17300) Actin-7| Length = 376 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376
>ACT2_ORYSA (P17298) Actin-2| Length = 377 Score = 81.6 bits (200), Expect = 8e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377
>ACT1_PNECA (P43239) Actin-1 (Actin I)| Length = 375 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDE+GPSIV+RKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDENGPSIVYRKCF 375
>ACTM_STYPL (Q00214) Actin, muscle| Length = 379 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIG SILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 340 KYSVWIGASILASLSTFQQMWITKQEYDESGPSIVHRKCF 379
>ACT1_AEDAE (P49128) Actin-1| Length = 376 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ MWISK EYDESGP+IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQAMWISKQEYDESGPAIVHRKCF 376
>ACT_SCHPO (P10989) Actin| Length = 375 Score = 80.9 bits (198), Expect = 1e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EYDESGP IV+RKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVYRKCF 375
>ACT_KLULA (P17128) Actin| Length = 375 Score = 80.9 bits (198), Expect = 1e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQQMWISK EYDESGPSIVH KCF Sbjct: 336 KYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKCF 375
>ACT_ENCCU (Q8SWN8) Actin| Length = 375 Score = 80.9 bits (198), Expect = 1e-15 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMW+SK EY E GPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWVSKAEYQEHGPSIVHRKCF 375
>ACT2_PLAYO (Q7RPB4) Actin-2 (Actin II)| Length = 376 Score = 80.9 bits (198), Expect = 1e-15 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQ+MWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQKMWITKEEYDESGPSIVHRKCF 376
>ACT2_PLABA (Q4YU79) Actin-2 (Actin II)| Length = 376 Score = 80.9 bits (198), Expect = 1e-15 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTFQ+MWI+K EYDESGPSIVHRKCF Sbjct: 337 KYSVWIGGSILSSLSTFQKMWITKEEYDESGPSIVHRKCF 376
>ACT_PHYME (P13363) Actin| Length = 375 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL+TFQ MWISK +YDESGPSIVHRKCF Sbjct: 336 KYSVWIGGSILASLATFQHMWISKTDYDESGPSIVHRKCF 375
>ACT_PICPA (Q9P4D1) Actin| Length = 376 Score = 80.5 bits (197), Expect = 2e-15 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL TFQQMWISK EYDESGPSIVH KCF Sbjct: 337 KYSVWIGGSILASLGTFQQMWISKQEYDESGPSIVHLKCF 376
>ACT_ENTHI (P11426) Actin| Length = 376 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ MWI+K EYDESGP+IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQNMWITKEEYDESGPAIVHRKCF 376
>ACT2_ECHGR (Q03341) Actin-2| Length = 376 Score = 80.5 bits (197), Expect = 2e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQQMWISK EY+E GPSIVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKVEYEEIGPSIVHRKCF 376
>ACTM_MOLOC (P53467) Actin, larval muscle-type (A1)| Length = 378 Score = 80.1 bits (196), Expect = 2e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSIL+SLSTF QMWI+K EYDE+GPSIVHRKCF Sbjct: 339 KYSVWIGGSILSSLSTFNQMWITKAEYDEAGPSIVHRKCF 378
>ACT_ACECL (P53491) Actin (Fragment)| Length = 353 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 K+SVWIGGSIL+SLSTFQQMWISK EYDE+GP+IVHRKCF Sbjct: 314 KFSVWIGGSILSSLSTFQQMWISKEEYDEAGPAIVHRKCF 353
>ACT1_SOYBN (P02581) Actin-1| Length = 377 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 K+ VWIGGSILASLSTFQQMWI K EYDESGPSIVH+KCF Sbjct: 338 KFGVWIGGSILASLSTFQQMWIXKAEYDESGPSIVHKKCF 377
>ACT_PROCL (P45521) Actin (Fragment)| Length = 322 Score = 79.7 bits (195), Expect = 3e-15 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASLSTFQ MWI+K EYDESGP IVHRKCF Sbjct: 283 KYSVWIGGSILASLSTFQTMWITKEEYDESGPGIVHRKCF 322
>ACT_YARLI (Q9UVF3) Actin| Length = 375 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 KYSVWIGGSILASL TFQQMWISK EYDE+GP+IVHRKC+ Sbjct: 336 KYSVWIGGSILASLGTFQQMWISKQEYDEAGPTIVHRKCY 375
>ACT1_TETTH (P10992) Actin, macronuclear| Length = 375 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 438 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 319 +YSVWIGGSIL+SLSTFQ MWI+K EYDESGPSIVHRKCF Sbjct: 336 RYSVWIGGSILSSLSTFQTMWITKAEYDESGPSIVHRKCF 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,368,520 Number of Sequences: 219361 Number of extensions: 1587608 Number of successful extensions: 5116 Number of sequences better than 10.0: 381 Number of HSP's better than 10.0 without gapping: 4921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5107 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
