| Clone Name | rbaet95f11 |
|---|---|
| Clone Library Name | barley_pub |
>LPHN3_BOVIN (O97827) Latrophilin-3 precursor| Length = 1580 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -3 Query: 191 PFVHTARRSYR---LNGPVKCSDRGDGGGLPP 105 P +H + S R L P++ ++RG GG LPP Sbjct: 15 PIIHGGKHSERHPALASPLRHAERGPGGALPP 46
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 111 QTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 227 +TAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161
>HCN3_HUMAN (Q9P1Z3) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 3 Length = 774 Score = 28.5 bits (62), Expect = 4.4 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 10/92 (10%) Frame = -3 Query: 263 LQLLVFNEECLVSASHQ---LALTTSLPFVHTARRSYRLNG-------PVKCSDRGDGGG 114 LQ ++ +HQ L L+ P AR ++R G PV+ Sbjct: 611 LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPVRAGPWASTSR 670 Query: 113 LPPPTSREVH*TLSFRGRRSCNKVSVGEPAEG 18 LP P +R +H +LS GR ++VS+ P G Sbjct: 671 LPAPPARTLHASLSRAGR---SQVSLLGPPPG 699
>CABP2_MOUSE (Q9JLK4) Calcium-binding protein 2 (CaBP2)| Length = 215 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 73 DKVQWTSRDVGGGKPPPSPRSEHFTG 150 ++ QW +GG +P P PR+E G Sbjct: 14 ERWQWPGSPLGGSRPSPGPRTEEQEG 39
>TR10A_HUMAN (O00220) Tumor necrosis factor receptor superfamily member 10A| precursor (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL-R1) (CD261 antigen) Length = 468 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = +1 Query: 82 QWTSRDVGGGKPPPSPRSEHFTGPFNR*ERRAVCTKGRDVVNAS 213 QW +G PP S RSEH G NR CT+G NAS Sbjct: 122 QWEHSPLGELCPPGSHRSEH-PGACNR------CTEGVGYTNAS 158
>COG6_HUMAN (Q9Y2V7) Conserved oligomeric Golgi complex component 6| Length = 605 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -3 Query: 179 TARRSYRLNGPVKCSDRGDGGGLPPPTSREVH*TLSFRG 63 TARRS + G + RG GG P P H L + G Sbjct: 219 TARRSTVVRGFIDALTRGGPGGTPRPIEMHSHDPLRYVG 257
>PCGF6_MOUSE (Q99NA9) Polycomb group RING finger protein 6 (RING finger protein| 134) (Mel18 and Bmi1-like RING finger) Length = 353 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 92 LATSGAANRPRRRDPNTSPDHSIGRSDGR 178 L +GAA R R P P+ S+GR GR Sbjct: 52 LGQAGAAGCSRSRPPALEPERSLGRLRGR 80
>RL3_STRR6 (Q8CWV8) 50S ribosomal protein L3| Length = 208 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +3 Query: 30 FTYGNLVTTSPSSK**GSMDFSRRRGRQTAPVAAIRTLHRTIQSVG--ATGGVYKGQGRS 203 F G++V + +SK G +R G+ P+A HR S+G A V+KG+ + Sbjct: 100 FAAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLA 159 Query: 204 QR 209 R Sbjct: 160 GR 161
>RL3_STRPN (Q97SV5) 50S ribosomal protein L3| Length = 208 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +3 Query: 30 FTYGNLVTTSPSSK**GSMDFSRRRGRQTAPVAAIRTLHRTIQSVG--ATGGVYKGQGRS 203 F G++V + +SK G +R G+ P+A HR S+G A V+KG+ + Sbjct: 100 FAAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLA 159 Query: 204 QR 209 R Sbjct: 160 GR 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,774,535 Number of Sequences: 219361 Number of extensions: 1102705 Number of successful extensions: 2690 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2685 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)