Clone Name | rbaet95c10 |
---|---|
Clone Library Name | barley_pub |
>CD8B_FELCA (P79336) T-cell surface glycoprotein CD8 beta chain precursor (CD8b| antigen) Length = 210 Score = 30.0 bits (66), Expect = 3.0 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +2 Query: 146 GKGN*LQDSRAKPTRELATSKTTRRFCCCRLATTLTTELTFCGASAMARHASGVALLWIS 325 GKG L PT T K T R CR + +T + CG + +GV +L +S Sbjct: 127 GKGTRLSVVDVLPTNSQPTKKPTPRKKMCRPPSPVTQKGPSCGLLTLGLLVAGVLVLLVS 186 Query: 326 V 328 + Sbjct: 187 L 187
>TAF4_DROME (P47825) Transcription initiation factor TFIID subunit 4| (Transcription initiation factor TFIID 110 kDa subunit) (p110) (TAFII-110) (110 kDa TBP-associated factor) Length = 921 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 356 PPSMWIVTAGAPPAATSSVLKHVSNAPSDVYPL 454 PPS+ ++ G PP T SVL +++A + P+ Sbjct: 527 PPSLAAISGGPPPTPTLSVLSTLNSASTTTLPI 559
>FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.4.1.65) (Blood| group Lewis alpha-4-fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (FUCT-III) (FUTB) Length = 365 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 305 VALLWISVFSMGSARSTPPSMWIVTAGAPPAATSSVLKHV 424 +AL + S M + P MW+ GAP AT H+ Sbjct: 26 LALCFFSYLRMSQEKPKPKPMWVSELGAPSQATEGSSAHL 65
>CDC16_SCHPO (P36618) Cell division control protein 16| Length = 299 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 338 GSARSTPPSMWIVTAGAPPAATSSVLKHVSNAPS 439 G ST P +W V APP +++V PS Sbjct: 41 GGNSSTRPYVWAVLLNAPPRNADEYIRYVRQGPS 74
>PALY_RHOTO (P11544) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 716 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 188 ASASPGSPATSFLSHRTTFLHAFAQ 114 ++AS SPA S+LS RT L+AF + Sbjct: 646 SAASTSSPALSYLSPRTQILYAFVR 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,866,994 Number of Sequences: 219361 Number of extensions: 690675 Number of successful extensions: 2286 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2285 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)