Clone Name | rbaet95b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FIXI_BRAJA (Q59207) Nitrogen fixation protein fixI (E1-E2 type c... | 33 | 0.25 | 2 | FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fi... | 32 | 0.71 | 3 | IF2_DESDG (Q30WJ0) Translation initiation factor IF-2 | 31 | 1.2 | 4 | ANR50_HUMAN (Q9ULJ7) Ankyrin repeat domain-containing protein 50 | 31 | 1.2 | 5 | GCKR_RAT (Q07071) Glucokinase regulatory protein (Glucokinase re... | 29 | 6.0 |
---|
>FIXI_BRAJA (Q59207) Nitrogen fixation protein fixI (E1-E2 type cation ATPase| fixI) (EC 3.6.3.-) Length = 730 Score = 33.5 bits (75), Expect = 0.25 Identities = 24/63 (38%), Positives = 32/63 (50%) Frame = +1 Query: 238 APAPVSDQQRAAPVSGAHAPWPVDDLILLGRHLDHPIPAPVSAAILVAPFAAVLPRPDLH 417 AP+ + +P+S AH DL+ LGR L APV+AAI A A L R +L Sbjct: 627 APSLAAAHVSMSPISAAHLSQATADLVFLGRPL-----APVAAAIDSARKALHLMRQNLW 681 Query: 418 LGV 426 L + Sbjct: 682 LAI 684
>FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fibrinopeptide| A] Length = 782 Score = 32.0 bits (71), Expect = 0.71 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 411 IWTRQDGGKGSDEDCGGDWRRDRVVEMTPEQNQIVDRPRC 292 +WT G + GGD R R+VE P Q + D P C Sbjct: 17 VWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFC 56
>IF2_DESDG (Q30WJ0) Translation initiation factor IF-2| Length = 984 Score = 31.2 bits (69), Expect = 1.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 417 VEIWTRQDGGKGSDEDCGGDWRRDRVVEMTPEQNQIVDRPR 295 VE + GGK ED GG+W R + + PE + +P+ Sbjct: 356 VEFGDKGAGGKKMREDVGGNWNRGKKGKRKPETKPVSTQPQ 396
>ANR50_HUMAN (Q9ULJ7) Ankyrin repeat domain-containing protein 50| Length = 1375 Score = 31.2 bits (69), Expect = 1.2 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = +1 Query: 148 DGHGGLVVAEAM---EVVRHLL-HGATFQMQDVHAPAPVSDQQRAAPVSGAHAPWPVDDL 315 +G L+ A M E+V HLL HGA +DV +S P S HA V L Sbjct: 622 EGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHAS-VVSLL 680 Query: 316 ILLGRHLDH 342 I G +DH Sbjct: 681 IDRGAEVDH 689
>GCKR_RAT (Q07071) Glucokinase regulatory protein (Glucokinase regulator)| Length = 626 Score = 28.9 bits (63), Expect = 6.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 223 MQDVHAPAPVSDQQRAAPVS 282 +Q +H P P+SD RAAP+S Sbjct: 538 LQAIHFPQPLSDDVRAAPIS 557 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,836,222 Number of Sequences: 219361 Number of extensions: 1134731 Number of successful extensions: 3694 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3686 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)