Clone Name | rbaet95a09 |
---|---|
Clone Library Name | barley_pub |
>UPPS_STRA5 (Q8DXD5) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 250 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -2 Query: 156 LFCRSDSALLISSLLPWHPCNRHHHFVAVTSYDRLMDE*NEVIRDYHMPH 7 L R+ L +S+ LPW +F V D DE ++ I DY+ H Sbjct: 195 LIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRH 244
>UPPS_STRA3 (Q8E359) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 250 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -2 Query: 156 LFCRSDSALLISSLLPWHPCNRHHHFVAVTSYDRLMDE*NEVIRDYHMPH 7 L R+ L +S+ LPW +F V D DE ++ I DY+ H Sbjct: 195 LIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRH 244
>MUS81_HUMAN (Q96NY9) Crossover junction endonuclease MUS81 (EC 3.1.22.-)| Length = 551 Score = 29.3 bits (64), Expect = 5.5 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = -3 Query: 344 RKELDEFVAGAFDGPFREAVSMLSK----RRTYLLEMNG 240 RK LD+ + DG FRE L + RR YL+E +G Sbjct: 334 RKRLDDLCSSIIDGRFREQKFRLKRCGLERRVYLVEEHG 372
>LOXL4_HUMAN (Q96JB6) Lysyl oxidase homolog 4 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 4) (Lysyl oxidase-related protein C) Length = 756 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 108 WHPCNRHHHFVAV-TSYDRL 52 WH C+RH+H + V T YD L Sbjct: 607 WHQCHRHYHSIEVFTHYDLL 626
>LOXL4_BOVIN (Q8MJ24) Lysyl oxidase homolog 4 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 4) Length = 757 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 108 WHPCNRHHHFVAV-TSYDRL 52 WH C+RH+H + V T YD L Sbjct: 608 WHQCHRHYHSIEVFTHYDLL 627 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,419,924 Number of Sequences: 219361 Number of extensions: 919409 Number of successful extensions: 2151 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2150 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)