Clone Name | bastl56h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LIFO_CHRVO (Q7NUI5) Lipase chaperone (Lipase foldase) (Lipase he... | 35 | 0.059 | 2 | SSH3_MOUSE (Q8K330) Protein phosphatase Slingshot homolog 3 (EC ... | 30 | 2.5 |
---|
>LIFO_CHRVO (Q7NUI5) Lipase chaperone (Lipase foldase) (Lipase helper protein)| (Lipase activator protein) (Lipase modulator) Length = 303 Score = 35.4 bits (80), Expect = 0.059 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 99 ASQERAASRAALPNQEHRARRGGGSS---YELRAAATGEVASCCLGEEEEE 242 A++E AL + E R R+GGG Y+LRA G+ A+ LGE + E Sbjct: 198 AAREEPVKHLALADAEARLRQGGGGEQQLYQLRAGMVGQAAADRLGELDRE 248
>SSH3_MOUSE (Q8K330) Protein phosphatase Slingshot homolog 3 (EC 3.1.3.48) (EC| 3.1.3.16) (SSH-3L) (mSSH-3L) Length = 649 Score = 30.0 bits (66), Expect = 2.5 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +2 Query: 107 GAGREQSCITEPGAPSTPRRRQQLRAKSSSDWR 205 G G+EQS EPG STPR R+ +R S D R Sbjct: 615 GQGQEQS---EPGMSSTPRLRKVMRQASVDDSR 644 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,437,058 Number of Sequences: 219361 Number of extensions: 359647 Number of successful extensions: 1381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)