Clone Name | bastl56f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENAN_BPK1F (Q04830) Endo-N-acetylneuraminidase (EC 3.2.1.129) (E... | 30 | 1.9 | 2 | RHO_TREPA (O83281) Transcription termination factor rho (EC 3.6.... | 28 | 7.2 | 3 | Y06P_BPT4 (P39223) Hypothetical 23.8 kDa protein in e-segB inter... | 27 | 9.4 |
---|
>ENAN_BPK1F (Q04830) Endo-N-acetylneuraminidase (EC 3.2.1.129) (Endo-N)| (Endosialidase) (G102) Length = 919 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 7/56 (12%) Frame = +2 Query: 164 YIPGTDDTFSHPPTLFIDNNCEAPLVRKGTPTDLQC------PDD-VHRDERVGGI 310 Y+ G +D F+ P + DN+ + P G P+DL C PD+ V RD R G + Sbjct: 715 YMFGGEDHFN--PWTYGDNSAKDPFKSDGHPSDLYCYKMKIGPDNRVSRDFRYGAV 768
>RHO_TREPA (O83281) Transcription termination factor rho (EC 3.6.1.-)| (ATP-dependent helicase rho) Length = 519 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +2 Query: 38 FQIIGDRTSEKGCIVPLNFLDGSSKVLTIDQSLLKPNFGQEEYIPGTDDTFSHPPTLFID 217 F ++ + T G I F GS ++L L+ Q Y+PG+DD + P + + Sbjct: 135 FHVLKNHTENGGVI----FASGSLEILPDGYGFLRSP--QNSYLPGSDDIYVSPSQIRLF 188 Query: 218 N 220 N Sbjct: 189 N 189
>Y06P_BPT4 (P39223) Hypothetical 23.8 kDa protein in e-segB intergenic region| Length = 202 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -2 Query: 229 FTIIIDKQCWGVRKRVISSRNVFFLTKVRFQKGLVDS*HF 110 FT+I+D + KR++S RN+ + F K LV++ +F Sbjct: 139 FTLIVDSETKHENKRILSKRNILNIVDDLFDK-LVENPNF 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,043,424 Number of Sequences: 219361 Number of extensions: 1065031 Number of successful extensions: 2368 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2368 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)