Clone Name | bastl56e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | U5S1_HUMAN (Q15029) 116 kDa U5 small nuclear ribonucleoprotein c... | 51 | 1e-06 | 2 | U5S1_MOUSE (O08810) 116 kDa U5 small nuclear ribonucleoprotein c... | 51 | 1e-06 | 3 | TRA2_CAEEL (P34709) Sex-determining transformer protein 2 precur... | 28 | 7.4 |
---|
>U5S1_HUMAN (Q15029) 116 kDa U5 small nuclear ribonucleoprotein component (U5| snRNP-specific protein, 116 kDa) (U5-116 kDa) (Elongation factor Tu GTP-binding domain protein 2) (hSNU114) Length = 972 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +1 Query: 337 LAEDKKYYPTAEEVYGPGVEALVMDEDEQAL 429 L EDKKYYPTAEEVYGP VE +V +ED Q L Sbjct: 59 LHEDKKYYPTAEEVYGPEVETIVQEEDTQPL 89 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 115 MDDSLYDEFGNYI 153 MD LYDEFGNYI Sbjct: 1 MDTDLYDEFGNYI 13
>U5S1_MOUSE (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5| snRNP-specific protein, 116 kDa) (U5-116 kDa) (Elongation factor Tu GTP-binding domain protein 2) Length = 971 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +1 Query: 337 LAEDKKYYPTAEEVYGPGVEALVMDEDEQAL 429 L EDKKYYPTAEEVYGP VE +V +ED Q L Sbjct: 58 LHEDKKYYPTAEEVYGPEVETIVQEEDTQPL 88 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 115 MDDSLYDEFGNYI 153 MD LYDEFGNYI Sbjct: 1 MDTDLYDEFGNYI 13
>TRA2_CAEEL (P34709) Sex-determining transformer protein 2 precursor (Ce-Tra-2)| Length = 1475 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 20 PPLPSHPKSQTSPASFRRP 76 P LP HP++ PASF RP Sbjct: 1369 PNLPPHPRADQYPASFTRP 1387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,767,626 Number of Sequences: 219361 Number of extensions: 82993 Number of successful extensions: 365 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)