| Clone Name | bastl56c05 |
|---|---|
| Clone Library Name | barley_pub |
>CLAP1_HUMAN (Q7Z460) CLIP-associating protein 1 (Cytoplasmic linker-associated| protein 1) (Multiple asters homolog 1) Length = 1538 Score = 30.0 bits (66), Expect = 3.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 108 AAKPDARGRSRAGKIHEREHGHTPHPPHCLPRARKKAFLIAVGEGG 245 A+ PD RGRSRA + + + + +P R+ L+ G GG Sbjct: 654 ASTPDNRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGG 699
>YCAI_ECOLI (P37443) Hypothetical protein ycaI| Length = 754 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/63 (30%), Positives = 23/63 (36%), Gaps = 18/63 (28%) Frame = -2 Query: 283 GLWMRW---------------WWWCRAPPPSPTAIKKA---FLRARGRQWGGCGVWPCSL 158 G W+ W W PP T + A L+ GRQW G VW C L Sbjct: 252 GRWIHWQIPLIGGICCAAFYAWLTGMQPPALRTMVALATWGMLKLSGRQWSGWDVWICCL 311 Query: 157 SWI 149 + I Sbjct: 312 AAI 314
>PPIL4_EMENI (Q5ARI5) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 461 Score = 29.6 bits (65), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 130 PRASGFAAACKQRQQWRTPGVRDRDEKTRLNWIGSDRREGER 5 PR + + R R+P +RDRD + R ++ +DRR G R Sbjct: 410 PRRDSYRSRYGDRSNSRSPPLRDRD-RIRTDYYDNDRRRGYR 450
>TRI45_MOUSE (Q6PFY8) Tripartite motif protein 45| Length = 580 Score = 29.6 bits (65), Expect = 4.6 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 6/57 (10%) Frame = +3 Query: 39 FNLVFSSRSRT-PGVRHCCRCLQAAAKPDAR---GRSRAGKIHEREHGHTPHP--PH 191 FN+ + R PGV HCC + + AR G + G HGH HP PH Sbjct: 493 FNVTVRRKHRPHPGVFHCCTFCSSGGQKAARCACGGTMPGGYLGCGHGHKGHPGRPH 549
>SMRC1_HUMAN (Q92922) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily C member 1 (SWI/SNF complex 155 kDa subunit) (BRG1-associated factor 155) Length = 1105 Score = 29.6 bits (65), Expect = 4.6 Identities = 22/97 (22%), Positives = 38/97 (39%) Frame = +3 Query: 30 PIQFNLVFSSRSRTPGVRHCCRCLQAAAKPDARGRSRAGKIHEREHGHTPHPPHCLPRAR 209 P+ F S+++ P P+ R R + +R+H +P PP +R Sbjct: 293 PVSFRQRISTKNEEP-----------VRSPERRDRKASANARKRKHSPSP-PPPTPTESR 340 Query: 210 KKAFLIAVGEGGGAXXXXXXXXXKPQDHKEQTKRESE 320 KK+ G+ G A K +D +E ++ E Sbjct: 341 KKS-----GKKGQASLYGKRRSQKEEDEQEDLTKDME 372
>XE7_HUMAN (Q02040) B-lymphocyte antigen precursor (B-lymphocyte surface| antigen) (721P) (Protein XE7) Length = 695 Score = 29.3 bits (64), Expect = 6.0 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 323 AFRLCPAHGVYIKP---PVVSLVCVRSAAPLKSHFAWE 427 A LCPA+G+Y+KP +S+ + P KS WE Sbjct: 13 AVELCPAYGLYLKPITKMTISVALPQLKQPGKSISNWE 50
>HXB5_XENLA (P09019) Homeobox protein Hox-B5 (XlHbox-4) (Xhox-1B) (Fragment)| Length = 230 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 125 PGQVKSREDPRERTRPHSTPTPLPAASAQKS 217 PGQ SR + P STP PLP A +QKS Sbjct: 50 PGQESSRFRANQNC-PLSTPDPLPCAKSQKS 79
>FLGN_YEREN (Q56854) Flagella synthesis protein flgN| Length = 147 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 416 NGILTEQQSAHTPETLLVV*YTPHGQ 339 NG+L +Q H + L V+ YTPHGQ Sbjct: 102 NGLLLQQHIEHNTQALAVL-YTPHGQ 126
>AMC1_ORYSA (P27940) Alpha-amylase isozyme C (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) (Isozyme 1B) Length = 348 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Frame = -2 Query: 259 WCRAPPP-SPTA--IKKAFLRA-RGRQWGGCGVW 170 W +PPP SPT+ +++ L A + WGGC +W Sbjct: 61 WTTSPPPASPTSGSLRRPTLSASKATCWGGCTIW 94
>US6NL_HUMAN (Q92738) USP6 N-terminal-like protein (Related to the N-terminus of| tre) (RN-tre) Length = 828 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 75 GVRHCCRCLQAAAKPD--ARGRSRAGKIHEREHGHTPHP 185 GV H ++ +P A GR +G H R H H+PHP Sbjct: 381 GVHHLSNGQRSVGRPSPLASGRRESGAPHRR-HEHSPHP 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,698,463 Number of Sequences: 219361 Number of extensions: 1472441 Number of successful extensions: 4755 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4746 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)