Clone Name | bastl56c03 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 68.9 bits (167), Expect = 7e-12 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +3 Query: 291 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLK 449 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLK 107
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 68.9 bits (167), Expect = 7e-12 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +3 Query: 291 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLK 449 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLK 107
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 58.5 bits (140), Expect = 1e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 446 LEL V QD P + +L +++ IR++TSSMT+VPKPLKFLRPHY TL Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRPHYFTL 107
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 56.2 bits (134), Expect = 5e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 318 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 446 Q+ D + + ALE+M+ I+++TSSMT+VPKPLKFLRPHY T+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRPHYETM 90
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 53.1 bits (126), Expect = 4e-07 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 446 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLKFLRP Y L Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDL 98
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 48.1 bits (113), Expect = 1e-05 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL-KPTTKYAR 470 LE+ V + D + L +++ I+++TSSMT+VPKPLKFLRP Y L K K++ Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDLCKAYDKWSD 108 Query: 471 SELKST 488 + KS+ Sbjct: 109 KDQKSS 114
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 30.4 bits (67), Expect = 2.8 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ +A VPLAP +PP+P+P R A Sbjct: 1123 SDKEAPPPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>NIFS_BRAJA (P37030) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 393 Score = 30.0 bits (66), Expect = 3.6 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = -3 Query: 476 LRSGILRSRFKGSIVWAEELQRLGDRRHRACS*TNLLPHALEGEPL 339 +R G LR R + I+ E LGD R+R + TN+ LEGE + Sbjct: 266 IRIGALRDRLEQGILRNGECVVLGDIRNRLANTTNIAFDHLEGEAI 311
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 4.7 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 133 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 4.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 117 IRFGDGAGGLARVRGASGTEATRRCCVGVY 28 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 592 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 628
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 585 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 621
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 606 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 642
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 611 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 647
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.9 bits (63), Expect = 8.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ + VPLAP +PP+P+P R A Sbjct: 1118 SDKEAPPPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 130 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 14 RSSRK*TPTQQRRVASVPLAPRTLASPPAPSP 109 RS R + + V V PR +ASPPAPSP Sbjct: 76 RSPRSFLAKKLQLVRRVGAPPRRMASPPAPSP 107
>YACF_SHIFL (Q83MF4) UPF0289 protein yacF| Length = 247 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +3 Query: 330 PGVQRLALESMRQEIRSATSSMTSVPKPLKFLR 428 PGV + +E++ Q++++A S + S P+ +FLR Sbjct: 81 PGVDQSRIEALIQQLKAAVSVLISAPRIGQFLR 113
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNR 115 S ++ P ++ + VPLAP +PP+P+P R Sbjct: 1123 SDKEAPPPKEGTLTQVPLAPPPPGAPPSPAPAR 1155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,114,983 Number of Sequences: 219361 Number of extensions: 624392 Number of successful extensions: 3045 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3030 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)