Clone Name | bastl56a08 |
---|---|
Clone Library Name | barley_pub |
>FABH1_BACCR (Q81GM0) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 (EC| 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase III protein 1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1) Length = 310 Score = 30.0 bits (66), Expect = 2.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 235 EVRRGQKKDGDMGVGIGDGECAGGTSWWVLLLRW 134 E++ G+ +DGD+ + +G G GG +W + LRW Sbjct: 278 ELQNGRIQDGDLIILVGFG---GGLTWGAVALRW 308
>FABH1_BACAN (Q81JG0) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 (EC| 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase III protein 1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1) Length = 310 Score = 30.0 bits (66), Expect = 2.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 235 EVRRGQKKDGDMGVGIGDGECAGGTSWWVLLLRW 134 E++ G+ +DGD+ + +G G GG +W + LRW Sbjct: 278 ELQNGRIQDGDLIILVGFG---GGLTWGAVALRW 308
>MTSM_SERMA (P14230) Modification methylase SmaI (EC 2.1.1.113) (N-4| cytosine-specific methyltransferase SmaI) (M.SmaI) Length = 292 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 235 EVRRGQKKDGDMGVGIGDGECAGGTSW 155 +VRR K DG + + IGD +GG +W Sbjct: 84 DVRRTLKDDGTLWLNIGDSYTSGGRTW 110
>FABH_OCEIH (Q8ERU6) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 312 Score = 29.3 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 232 VRRGQKKDGDMGVGIGDGECAGGTSWWVLLLRW 134 V+ G+ KD D+ V +G G GG +W + LRW Sbjct: 281 VKEGKIKDNDLIVLVGFG---GGLTWGAVALRW 310
>FABH_STAS1 (Q49WB6) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 313 Score = 28.5 bits (62), Expect = 6.4 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 235 EVRRGQKKDGDMGVGIGDGECAGGTSWWVLLLRW 134 E+ G+ KD D+ V +G G GG +W + LRW Sbjct: 281 ELENGRIKDDDVLVLVGFG---GGLTWGAVTLRW 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,663,839 Number of Sequences: 219361 Number of extensions: 417979 Number of successful extensions: 1855 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1854 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)