| Clone Name | bastl55g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NDPA_PSEAE (Q9HXF7) Nucleoid-associated protein ndpA | 28 | 8.8 |
|---|
>NDPA_PSEAE (Q9HXF7) Nucleoid-associated protein ndpA| Length = 334 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 172 SYFTYLLGTGISYEEEEEGLLKRSKAEQLRQQ 77 S+ +LLG+ + Y+EE + L+ R QL+ Q Sbjct: 297 SFEAHLLGSKVEYDEERDMLIIRQLPTQLKDQ 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,219,996 Number of Sequences: 219361 Number of extensions: 147928 Number of successful extensions: 491 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)