| Clone Name | bastl55g01 |
|---|---|
| Clone Library Name | barley_pub |
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 73.2 bits (178), Expect = 3e-13 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 345 ADDENPEDFIDPETPSGQKESLAPXMAKQYSPSTVXXSWYAWW 473 A +ENPEDF+DPETP G+++ L+ MAKQYSP+TV SWYAWW Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPATVEKSWYAWW 153
>SYV_RAT (Q04462) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1264 Score = 38.9 bits (89), Expect = 0.007 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 375 DPETPSGQKESLAPXMAKQYSPSTVXXSWYAWW 473 D TP G+K+ ++ M YSP V +WY WW Sbjct: 281 DLPTPPGEKKDVSGTMPDSYSPQYVEAAWYPWW 313
>SYV_MOUSE (Q9Z1Q9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1263 Score = 38.9 bits (89), Expect = 0.007 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 375 DPETPSGQKESLAPXMAKQYSPSTVXXSWYAWW 473 D TP G+K+ ++ M YSP V +WY WW Sbjct: 280 DLPTPPGEKKDVSGAMPDSYSPQYVEAAWYPWW 312
>SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1217 Score = 38.9 bits (89), Expect = 0.007 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 375 DPETPSGQKESLAPXMAKQYSPSTVXXSWYAWW 473 D TPSG+K+ + + YSP V +WY WW Sbjct: 230 DIPTPSGEKKDVVSPLPDSYSPQYVEAAWYPWW 262
>SYV_HUMAN (P26640) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1264 Score = 37.7 bits (86), Expect = 0.015 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 375 DPETPSGQKESLAPXMAKQYSPSTVXXSWYAWW 473 D TP G+K+ ++ M YSP V +WY WW Sbjct: 281 DLPTPPGEKKDVSGPMPDSYSPRYVEAAWYPWW 313
>SYV_YEAST (P07806) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1104 Score = 34.7 bits (78), Expect = 0.13 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 366 DFIDPETPSGQK--ESLAPXMAKQYSPSTVXXSWYAWW 473 +FID P +K SL K Y+P+ V SWY WW Sbjct: 124 EFIDKTVPGEKKILVSLDDPALKAYNPANVESSWYDWW 161
>SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 980 Score = 32.3 bits (72), Expect = 0.64 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 366 DFIDPETPSGQK--ESLAPXMAKQYSPSTVXXSWYAWW 473 ++++ TP +K + L K Y+P V +WY WW Sbjct: 73 EYVEKTTPGEKKVLQDLDSPALKSYNPKAVESAWYDWW 110
>SYV_NEUCR (P28350) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1093 Score = 32.0 bits (71), Expect = 0.83 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 375 DPETPSGQK---ESLAPXMAKQYSPSTVXXSWYAWW 473 + TP+G+K +S Y+PS V +WY WW Sbjct: 118 EDSTPAGEKKVIQSFEHPHFSAYNPSAVEAAWYQWW 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,228,041 Number of Sequences: 219361 Number of extensions: 358415 Number of successful extensions: 1055 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)