Clone Name | bastl55e03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YUFK_BACSU (O05249) Hypothetical protein yufK | 31 | 1.9 | 2 | CYB_LEITA (P14548) Cytochrome b | 29 | 5.4 | 3 | ZDH15_RAT (Q2TGJ4) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zi... | 28 | 9.2 | 4 | ZDH15_MOUSE (Q8BGJ0) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (... | 28 | 9.2 | 5 | ZDH15_HUMAN (Q96MV8) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (... | 28 | 9.2 | 6 | CYSK_BUCAI (P57171) Cysteine synthase (EC 2.5.1.47) (O-acetylser... | 28 | 9.2 |
---|
>YUFK_BACSU (O05249) Hypothetical protein yufK| Length = 204 Score = 30.8 bits (68), Expect = 1.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 304 VLTWFQVLVLVALIFFAYHVYGTLLLATICG 396 ++ WF V+ L +F Y +Y TL L ++ G Sbjct: 141 IVIWFAVVTLAYFVFTVYRIYSTLSLMSLVG 171
>CYB_LEITA (P14548) Cytochrome b| Length = 371 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 303 CIDLVSGSCIGSLNFFCISCL-WYFIARYHLWTSNLPVV 416 C+ ++ G C+ L F C C WYF+ LW +L V Sbjct: 41 CMQIICGVCLAWLFFSCFICTNWYFV--LFLWDFDLGFV 77
>ZDH15_RAT (Q2TGJ4) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 28.5 bits (62), Expect = 9.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 301 RVLTWFQVLVLVALIFFAYHVY 366 RVL+W VLV+V ++ ++Y+ Y Sbjct: 18 RVLSWVPVLVIVLVVLWSYYAY 39
>ZDH15_MOUSE (Q8BGJ0) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 28.5 bits (62), Expect = 9.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 301 RVLTWFQVLVLVALIFFAYHVY 366 RVL+W VLV+V ++ ++Y+ Y Sbjct: 18 RVLSWVPVLVIVLVVLWSYYAY 39
>ZDH15_HUMAN (Q96MV8) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 28.5 bits (62), Expect = 9.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 301 RVLTWFQVLVLVALIFFAYHVY 366 RVL+W VLV+V ++ ++Y+ Y Sbjct: 18 RVLSWVPVLVIVLVVLWSYYAY 39
>CYSK_BUCAI (P57171) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase) Length = 315 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 242 GKGKSPGQHRIRS*GLGFVPRTL 174 GK PG H+I+ G GF+P+ L Sbjct: 217 GKAIEPGPHKIQGIGPGFIPKNL 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,656,155 Number of Sequences: 219361 Number of extensions: 1268942 Number of successful extensions: 2862 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2861 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)