Clone Name | bastl55d04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARCA_RHIET (O31017) Arginine deiminase (EC 3.5.3.6) (ADI) (Argin... | 30 | 2.3 | 2 | ICB1_HUMAN (Q5TEJ8) Induced by contact to basement membrane 1 pr... | 26 | 6.5 | 3 | MUC1_YEAST (P08640) Mucin-like protein 1 precursor | 28 | 8.8 |
---|
>ARCA_RHIET (O31017) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 409 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 29 PLFKKKTALLCSAPLSSFPPTPLPQTLLERSNGRPIHGGI 148 P K K+ +L + P + F P+P TL +R I+GG+ Sbjct: 129 PEVKAKSLMLSALPETDFVIPPIPNTLFQRDPSCWIYGGV 168
>ICB1_HUMAN (Q5TEJ8) Induced by contact to basement membrane 1 protein (Protein| ICB-1) Length = 643 Score = 25.8 bits (55), Expect(2) = 6.5 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 17 SSAHPLFKKKTALLCSAPLSSFPPTPLPQTLLERSNGRPIHGGIW 151 SS H F K LL S L+ P PL +LE GRPI W Sbjct: 237 SSRHVHFIKP--LLLSEVLAWEGPFPLSMEILEVPEGRPIFLSPW 279 Score = 21.2 bits (43), Expect(2) = 6.5 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 136 PWRNLVSSPAESYQVHFFFS 195 PWR L SS HF S Sbjct: 298 PWRVLASSKGRKVPRHFLVS 317
>MUC1_YEAST (P08640) Mucin-like protein 1 precursor| Length = 1367 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 5 TSPHSSAHPLFKKKTALLCSAPLSSFPPTPLPQTLLERSNGRPI 136 T PH P KKKT + + P P P + S+ P+ Sbjct: 286 TPPHHDTTPCTKKKTTTSKTCTKKTTTPVPTPSSSTTESSSAPV 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,075,152 Number of Sequences: 219361 Number of extensions: 349920 Number of successful extensions: 1245 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)