Clone Name | bastl54e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BCAS1_RAT (Q3ZB98) Breast carcinoma amplified sequence 1 homolog... | 30 | 2.8 | 2 | SL9A4_RAT (P26434) Sodium/hydrogen exchanger 4 (Na(+)/H(+) excha... | 28 | 8.2 |
---|
>BCAS1_RAT (Q3ZB98) Breast carcinoma amplified sequence 1 homolog (Protein| whose mRNA is enriched in synaptosomes 2) (Pmes-2) (Fragment) Length = 555 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 423 TPNCSHAESPSNKKDSSFLSILFLIINNMDGAP 325 +P S AE+PS KD SFL+ LF + + AP Sbjct: 142 SPPESQAEAPSRPKDFSFLNRLFKLDKGRESAP 174
>SL9A4_RAT (P26434) Sodium/hydrogen exchanger 4 (Na(+)/H(+) exchanger 4)| (NHE-4) (Solute carrier family 9 member 4) Length = 717 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -3 Query: 376 FLSLHSFSHNKQYGW---CTLLQYCLQLIVVSRITNFKVQNTFRS*DILLKEQ 227 F+ + + N ++ W C L +C +S T F V N FR+ +K+Q Sbjct: 369 FMGVSTVGKNHEWNWAFVCFTLAFCQIWRAISVFTLFYVSNQFRTFPFSIKDQ 421 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,879,515 Number of Sequences: 219361 Number of extensions: 972418 Number of successful extensions: 1951 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1951 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)