| Clone Name | bastl54b03 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 290 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPL Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPL 96
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 290 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPL Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPL 96
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/41 (43%), Positives = 30/41 (73%) Frame = +2 Query: 293 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPL Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPL 88
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 40.0 bits (92), Expect = 0.002 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +2 Query: 293 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 LEL V QD P + +L +++ IR++TSSMT+VPKPL Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPL 97
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 38.1 bits (87), Expect = 0.008 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = +2 Query: 317 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 Q+ D + + ALE+M+ I+++TSSMT+VPKPL Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPL 80
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 33.1 bits (74), Expect = 0.27 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +2 Query: 293 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPL 415 LE+ V + D + L +++ I+++TSSMT+VPKPL Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPL 89
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 30.4 bits (67), Expect = 1.7 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S ++ P ++ +A VPLAP +PP+P+P R A Sbjct: 1123 SDKEAPPPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 34 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 132 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 116 IRFGDGAGGLARVRGASGTEATRRCCVGVY 27 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S R+ +P QRR + P R ASPP P R P+ Sbjct: 585 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 621
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S R+ +P QRR + P R ASPP P R P+ Sbjct: 606 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 642 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 7 KRRSSRK*TPTQQRRVASVPLAPRTLASPP---APSPNRIRP 123 +RRS P ++RR + P RT + PP +PSP R P Sbjct: 571 RRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSP 612
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S R+ +P QRR + P R ASPP P R P+ Sbjct: 611 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 647
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S R+ +P QRR + P R ASPP P R P+ Sbjct: 592 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 628 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 7 KRRSSRK*TPTQQRRVASVPLAPRTLASPP---APSPNRIRP 123 +RRS P ++RR + P RT + PP +PSP R P Sbjct: 557 RRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSP 598
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 13 RSSRK*TPTQQRRVASVPLAPRTLASPPAPSP 108 RS R + + V V PR +ASPPAPSP Sbjct: 76 RSPRSFLAKKLQLVRRVGAPPRRMASPPAPSP 107
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 5.0 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 34 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 129 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNR 114 S ++ P ++ + VPLAP +PP+P+P R Sbjct: 1123 SDKEAPPPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.9 bits (63), Expect = 5.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 16 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 126 S ++ P ++ + VPLAP +PP+P+P R A Sbjct: 1118 SDKEAPPPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 3 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 98 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 3 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 98 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 3 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 98 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>YACF_SALTY (P67693) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 329 PGVQRLALESMRQEIRSATSSMTSVPK 409 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALTI (P67694) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 329 PGVQRLALESMRQEIRSATSSMTSVPK 409 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALPA (Q5PDD7) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 329 PGVQRLALESMRQEIRSATSSMTSVPK 409 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,912,909 Number of Sequences: 219361 Number of extensions: 360123 Number of successful extensions: 2123 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2108 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)