Clone Name | bastl54a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (U... | 30 | 3.1 | 2 | PAX8_RAT (P51974) Paired box protein Pax-8 | 29 | 6.8 | 3 | KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-ass... | 28 | 8.9 | 4 | KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-ass... | 28 | 8.9 |
---|
>KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (UHS keratin)| Length = 182 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 111 CSAGCAWECAFVDWIGVRGAARVCSSSCCWAFLCC 7 CS GC C G CSSSCC CC Sbjct: 6 CSGGCGSSCG-----GCGSRCGGCSSSCCVPVCCC 35
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 276 PAVASDPAPPQRILRQPFLDLVMVGSGGSLAPHLP 172 P ++S + P + FLDL VGSGG +P Sbjct: 314 PELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVP 348
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 111 CSAGCAWECAFVDWIGVRGAARVCSSSCCWAFLCC 7 CS GC C G C SSCC CC Sbjct: 6 CSGGCGSGCG-----GCGSGCGGCGSSCCVPICCC 35
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 111 CSAGCAWECAFVDWIGVRGAARVCSSSCCWAFLCC 7 CS GC C G C SSCC CC Sbjct: 6 CSGGCGSGCG-----GCGSGCGGCGSSCCVPICCC 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,728,114 Number of Sequences: 219361 Number of extensions: 494578 Number of successful extensions: 1580 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1580 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)