Clone Name | bastl53e11 |
---|---|
Clone Library Name | barley_pub |
>PPK_MYCLE (O33127) Polyphosphate kinase (EC 2.7.4.1) (Polyphosphoric acid| kinase) (ATP-polyphosphate phosphotransferase) Length = 739 Score = 29.3 bits (64), Expect = 2.3 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = -3 Query: 212 REHRWVLRTVRVLCAAAMSQARLLLREREQGRIESEPEGAVMMRVMRGERDREVDVSVR 36 RE W+ RVL AA + LL R + S + M+RV +R E+D+SVR Sbjct: 52 RESSWLDFNARVLALAADNSLPLLERAKFLAIFASNLDEFYMVRVAGLKRRDEMDLSVR 110
>FUT4_PANTR (Q659K9) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 405 Score = 28.5 bits (62), Expect = 4.0 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 14/60 (23%) Frame = -2 Query: 408 GRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCDWPSRLRRRHCWCRPW 271 GRRRW GRG P AG T W L P PW PSR W P+ Sbjct: 14 GRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPF 73
>XLNR_ASPNG (O42804) Transcriptional activator xlnR| Length = 875 Score = 28.5 bits (62), Expect = 4.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 354 PAWVPLPAPWPCDWPS 307 P W+PLP+P P ++PS Sbjct: 268 PGWLPLPSPSPANFPS 283
>SYH_SILPO (Q5LVN3) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 495 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -3 Query: 149 RLLLREREQGRIESEPEGAVMMRVMRGERDREVD 48 RLL RE+GRI + G V++ VM +RDR D Sbjct: 364 RLLAALREKGRIRTAERGPVVVTVM--DRDRMAD 395
>PELB_COLGL (O59939) Pectate lyase B precursor (EC 4.2.2.2)| Length = 331 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 354 PAWVPLPAPWPCDWPSRLRRR 292 P+W+PLPAP P PS RRR Sbjct: 11 PSWLPLPAP-PPPLPSVTRRR 30
>Y2251_LISIN (Q929M4) Hypothetical UPF0324 membrane protein lin2251| Length = 335 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 396 WVAGRGTPAGTRTRPAWVPLPAPW 325 +V + AGT+ R +W LP PW Sbjct: 230 FVVAKMVNAGTKNRFSWAELPVPW 253
>Y2179_LISMF (Q71XL9) Hypothetical UPF0324 membrane protein LMOf2365_2179| Length = 335 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 396 WVAGRGTPAGTRTRPAWVPLPAPW 325 +V + AGT+ R +W LP PW Sbjct: 230 FVVAKMVNAGTKNRFSWAELPVPW 253
>Y2147_LISMO (Q8Y5B8) Hypothetical UPF0324 membrane protein lmo2147| Length = 335 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 396 WVAGRGTPAGTRTRPAWVPLPAPW 325 +V + AGT+ R +W LP PW Sbjct: 230 FVVAKMVNAGTKNRFSWAELPVPW 253
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 378 TPAGTRTRPAWVPLPAPWPCDWPSRLRRR 292 +PA + PAW+P+PA + P+R R+ Sbjct: 1235 SPAFSPRSPAWIPVPARREAEKPTREERK 1263
>PO5F1_BOVIN (O97552) POU domain, class 5, transcription factor 1| (Octamer-binding transcription factor 3) (Oct-3) (Oct-4) Length = 360 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -2 Query: 402 RRWVAGRGTPAGTRTRPAWVPLPAPW---PCDWPSRLRRRHCWCRP 274 R W++ +G P G+ P VP W PC P L +C P Sbjct: 33 RTWMSFQGPPGGSGIGPGVVPGAEVWGLPPCPPPYDLCGGMAYCAP 78
>CFAH_BOVIN (Q28085) Complement factor H (H factor 1) (Fragments)| Length = 685 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -2 Query: 384 RGTPAGTRTRPAWVPLP-APW-PCDWP 310 RGT A T TR WVP+P W PC +P Sbjct: 228 RGTDA-TCTRDGWVPVPRCAWKPCSYP 253
>RGMC_HUMAN (Q6ZVN8) Hemojuvelin precursor (Hemochromatosis type 2 protein)| (RGM domain family member C) Length = 426 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 375 PAGTRTRPAWVPLPAPWPCDWPSRLRRRH 289 P G A LPAP PCD+ R R H Sbjct: 130 PRGPALPGAGSGLPAPDPCDYEGRFSRLH 158
>LATS2_HUMAN (Q9NRM7) Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Large| tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) (Kinase phosphorylated during mitosis protein) (Warts-like kinase) Length = 1088 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 360 TRPAWVPLPAPWPCDWPS 307 + PAWVP PAP P P+ Sbjct: 461 SHPAWVPAPAPAPAPAPA 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.124 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,382,214 Number of Sequences: 219361 Number of extensions: 618367 Number of successful extensions: 2345 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2343 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)