Clone Name | bastl53c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | STAT1_PIG (Q764M5) Signal transducer and activator of transcript... | 32 | 0.95 | 2 | STAT1_HUMAN (P42224) Signal transducer and activator of transcri... | 32 | 0.95 | 3 | BCL9_DROME (Q961D9) Bcl-9 homolog (Protein legless) | 29 | 4.7 | 4 | PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Pro... | 28 | 8.1 |
---|
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -2 Query: 279 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 172 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -2 Query: 279 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 172 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>BCL9_DROME (Q961D9) Bcl-9 homolog (Protein legless)| Length = 1469 Score = 29.3 bits (64), Expect = 4.7 Identities = 26/93 (27%), Positives = 39/93 (41%) Frame = -3 Query: 431 PDHSIGRSDGRCVQRAGT*STRADDSRLLGIPR*RPTIAMIYPHHDEISQDYPGLSAKAI 252 P HSI RS + T S L +P R T A++ + S D G + ++ Sbjct: 766 PYHSIQRSASVPI---ATQSPNPSSPNNLSLPSPRTTAAVMGLPTNSPSMDGTGSLSGSV 822 Query: 251 YSLNTSV*RACGPEHLRASQTCYCLKLPSPKRR 153 NTS +A L A++ C+ PSP + Sbjct: 823 PQANTSTVQAGTTTVLSANKNCFQADTPSPSNQ 855
>PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, EP4 subtype) Length = 488 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 93 SAC*LAMRSHPSAASFLEGLSPFRRRK-FEAITG 191 +A +A R HP+A+ L LS FRRR+ F I G Sbjct: 232 AAASVASRGHPAASPALPRLSDFRRRRSFRRIAG 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,859,793 Number of Sequences: 219361 Number of extensions: 1329098 Number of successful extensions: 2743 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2743 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)