Clone Name | bastl53c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOP14_HUMAN (P78316) Probable nucleolar complex protein 14 | 50 | 2e-06 | 2 | NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14 | 49 | 6e-06 | 3 | NOP14_SCHPO (O43051) Probable nucleolar complex protein 14 | 34 | 0.21 |
---|
>NOP14_HUMAN (P78316) Probable nucleolar complex protein 14| Length = 857 Score = 50.4 bits (119), Expect = 2e-06 Identities = 24/58 (41%), Positives = 39/58 (67%) Frame = +3 Query: 291 SNPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHERENTLLKEFEQSAQSSVFHDR 464 SNPFE +R+KF +LG+K + + SR+ A+ +R TLLKE+++ +S+VF D+ Sbjct: 29 SNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDK 86
>NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14| Length = 860 Score = 48.9 bits (115), Expect = 6e-06 Identities = 23/57 (40%), Positives = 38/57 (66%) Frame = +3 Query: 294 NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHERENTLLKEFEQSAQSSVFHDR 464 NPFE +R+KF +LG+K + + SR+ A+ +R TLLKE+++ +S+VF D+ Sbjct: 30 NPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADK 86
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 33.9 bits (76), Expect = 0.21 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +3 Query: 294 NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHERENTLLKEFEQSAQSSVFHDR 464 N F+ +++RKFDV G++ KG E + SR R T+ E ++ +S DR Sbjct: 52 NLFDRQFTKRKFDVGGRRVKGTEGKPGVSRGVGEELRRRTIGAELKKRNRSGAIIDR 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.121 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,412,544 Number of Sequences: 219361 Number of extensions: 405555 Number of successful extensions: 1323 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)