| Clone Name | bastl53b01 |
|---|---|
| Clone Library Name | barley_pub |
>NIFS_FRASE (Q9Z5X5) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 419 Score = 31.6 bits (70), Expect = 0.95 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +3 Query: 114 RPEDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDHTGRSFGTYPAVLLYRPRS 293 RP E+ AG RCC D T AL R PV + TG A LY P+ Sbjct: 166 RPLVEAARSAG------RCCCADVTQ-----ALGRVPVEFERTGVDLAVSSAHKLYGPKG 214 Query: 294 VS---LQKIKWPR 323 V K W R Sbjct: 215 VGALIASKDAWSR 227
>VTI13_ARATH (Q9LVP9) Vesicle transport v-SNARE 13 (AtVTI13) (Vesicle transport| v-SNARE protein VTI13) (Vesicle soluble NSF attachment protein receptor 13) Length = 221 Score = 29.3 bits (64), Expect = 4.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 254 ERTTSVIKSDGSPRERKACEICSGVEKAAALTR 156 ++ TS I DG +++ EI SGVE+A AL + Sbjct: 21 KKCTSAIALDGEQKKQNLSEIKSGVEEAEALVK 53
>NDUA5_HUMAN (Q16718) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit| 5 (EC 1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit) (Complex I-13Kd-B) (CI-13Kd-B) (Complex I subunit B13) Length = 115 Score = 28.5 bits (62), Expect = 8.1 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +2 Query: 290 IC*SPKDQMAEAVLIVVTKIGDILLEEATKSVIAKISEKVTNLKELPVKVE 442 +C +P +++ I+ TKI D+L E + K +E++TN K VK E Sbjct: 15 VCNTPHERLR----ILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAE 61
>ACDD2_METAC (Q8TJC2) Acetyl-CoA decarbonylase/synthase complex delta subunit 2| (ACDS complex delta subunit 2) (Corrinoid/iron-sulfur component small subunit 2) Length = 436 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278
>ACDD1_METAC (Q8TRZ8) Acetyl-CoA decarbonylase/synthase complex delta subunit 1| (ACDS complex delta subunit 1) (Corrinoid/iron-sulfur component small subunit 1) Length = 436 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,486,658 Number of Sequences: 219361 Number of extensions: 992669 Number of successful extensions: 2619 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2618 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)