| Clone Name | bastl53a11 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 56.2 bits (134), Expect = 3e-08 Identities = 21/36 (58%), Positives = 34/36 (94%) Frame = +2 Query: 332 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 439 ++A+ +V+YDH+A++I+G +R+L+SGSIHYPRSTP+ Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPE 55
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 55.1 bits (131), Expect = 8e-08 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +2 Query: 335 SAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 439 + +VTYDH++++I+G RR+L+SGSIHYPRSTP+ Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPE 56
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 53.1 bits (126), Expect = 3e-07 Identities = 19/31 (61%), Positives = 30/31 (96%) Frame = +2 Query: 347 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 439 +V+YDH+A++++G R++L+SGSIHYPRSTP+ Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPE 53
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 52.4 bits (124), Expect = 5e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +2 Query: 329 GTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 439 G++ +T V++D RA+ IDG RR+L+SGSIHYPRST D Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSD 56
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 48.9 bits (115), Expect = 5e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +2 Query: 347 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 439 NV YD+RA+ I+ RR+L+SGSIHYPRSTP+ Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPE 60
>TTGH_PSEPU (Q93PU4) Toluene efflux pump membrane transporter ttgH| Length = 1049 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 254 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 168 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>SRPB_PSEPU (O31100) Solvent resistant pump membrane transporter srpB| Length = 1049 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 254 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 168 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,887,208 Number of Sequences: 219361 Number of extensions: 375167 Number of successful extensions: 1125 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)