Clone Name | bastl50e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12) | 30 | 3.2 | 2 | SPDYB_MOUSE (Q5IBH6) Speedy protein B (Rapid inducer of G2/M pro... | 29 | 5.4 |
---|
>LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 30.0 bits (66), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = -1 Query: 353 TVRLLKSSAVDDDSGGPD----EPELDGWLTVLSS 261 T +L+ S+AVD D+GG E EL+ W+T L S Sbjct: 53 TCQLISSTAVDQDNGGRGKVGAEAELEQWVTSLPS 87
>SPDYB_MOUSE (Q5IBH6) Speedy protein B (Rapid inducer of G2/M progression in| oocytes B) (RINGO B) (mSpy/Ringo B) Length = 268 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 407 MTLGSTSACSRIETAAPGTVRLLKSSAVDDDSGGPDEPELD 285 +T G S CS ++ PG R VD +S G EP ++ Sbjct: 36 VTAGQLSLCSEEQSPQPGITRPSPGVVVDGESSGLAEPRVE 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,341,695 Number of Sequences: 219361 Number of extensions: 376737 Number of successful extensions: 1215 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1215 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)