Clone Name | bastl50b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALF_ECHMU (Q9GP32) Fructose-bisphosphate aldolase (EC 4.1.2.13) | 32 | 1.0 | 2 | NUOG_STRCO (Q9XAR0) NADH-quinone oxidoreductase chain G (EC 1.6.... | 28 | 8.6 | 3 | PLDZ1_ARATH (P58766) Phospholipase D zeta (EC 3.1.4.4) (AtPLDzet... | 28 | 8.6 |
---|
>ALF_ECHMU (Q9GP32) Fructose-bisphosphate aldolase (EC 4.1.2.13)| Length = 363 Score = 31.6 bits (70), Expect = 1.0 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = -3 Query: 169 EPVTRLLPEEGVLPGVK-----TICSGGSESCACEGRDSSARRPVLLLSQYFS 26 +P LL E GVLPG+K G ++ C +G D+ A+R +QY++ Sbjct: 92 KPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQR----CAQYYN 140
>NUOG_STRCO (Q9XAR0) NADH-quinone oxidoreductase chain G (EC 1.6.99.5) (NADH| dehydrogenase I, chain G) (NDH-1, chain G) Length = 843 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 216 DSAGQKMGCTVSLRLEKR--LTI*VTCRTSMILRALLLS*TEPLVEHGILVLLVTDDP 383 D AG C V + +++ + +TC M+++ L S +HG++ LL+ + P Sbjct: 60 DPAGACRQCIVEVEGQRKPMASCTITCTDGMVVKTQLTSPVAEKAQHGVMELLLINHP 117
>PLDZ1_ARATH (P58766) Phospholipase D zeta (EC 3.1.4.4) (AtPLDzeta) (PLD zeta)| Length = 820 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 27 EKYWERSSTGRRAELSLPSHAQLSDPPLQIV 119 E+ W + +GRR +S+ A+++ PPL IV Sbjct: 430 EQRWMKQGSGRRYLISMAQLAEITVPPLPIV 460 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,146,654 Number of Sequences: 219361 Number of extensions: 701974 Number of successful extensions: 2153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2153 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)