| Clone Name | bastl50a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MED4_MOUSE (Q9CQA5) Mediator complex subunit 4 (Mediator of RNA ... | 29 | 5.5 | 2 | RS13_THEVO (Q97B96) 30S ribosomal protein S13P | 28 | 7.2 | 3 | CCNL1_CHICK (Q5ZJP9) Cyclin-L1 | 28 | 9.4 | 4 | RF3_PHOLL (Q7MZN3) Peptide chain release factor 3 (RF-3) | 28 | 9.4 |
|---|
>MED4_MOUSE (Q9CQA5) Mediator complex subunit 4 (Mediator of RNA polymerase II| transcription subunit 4) Length = 270 Score = 28.9 bits (63), Expect = 5.5 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -3 Query: 145 GNFGGNQLLDGSIS--LSPLYPSQTNDLHVSIASSLHQSFLWLRP 17 G+ G+ L G + L+P YP Q+ND+ V++ H S L P Sbjct: 200 GHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSSDFLLEP 244
>RS13_THEVO (Q97B96) 30S ribosomal protein S13P| Length = 171 Score = 28.5 bits (62), Expect = 7.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 334 GMNRKPGYGAQLRANLEPTKGVGRLRQQD 420 G+ + GY R NL+PTK +G L++ + Sbjct: 54 GIGLRLGYAIAERLNLQPTKKIGELKEDE 82
>CCNL1_CHICK (Q5ZJP9) Cyclin-L1| Length = 534 Score = 28.1 bits (61), Expect = 9.4 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +2 Query: 254 GSAASVSRATESGAPSGPFLVSRTGDAG*TGSRVTVP 364 GSAA+V+ A G P+GP T A TGS VP Sbjct: 6 GSAAAVA-AVAGGGPAGPHAAGVTAGAVTTGSGAPVP 41
>RF3_PHOLL (Q7MZN3) Peptide chain release factor 3 (RF-3)| Length = 529 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 145 GNFGGNQLLDGSISLSPL-YPSQTNDLHVSIASSLHQSFLW 26 GNFG N +LDG + +P P QT+ VS F++ Sbjct: 261 GNFGVNHMLDGLVKWAPAPMPRQTDVREVSAQEDKFTGFIF 301 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,402,890 Number of Sequences: 219361 Number of extensions: 1431588 Number of successful extensions: 3449 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3448 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)